(data stored in ACNUC1104 zone)

EMBL: BX640427.PE19

BX640427.PE19        Location/Qualifiers
FT   CDS             complement(17594..18784)
FT                   /transl_table=11
FT                   /locus_tag="BPP1310"
FT                   /product="putative FAD dependent oxidoreductase"
FT                   /note="Similar to Ralstonia solanacearum hypothetical
FT                   transmembrane protein Rsp1590 or Rs02147 SWALL:Q8XPP8
FT                   (EMBL:AL646085) (398 aa) fasta scores: E(): 6.5e-50, 37.72%
FT                   id in 387 aa, and to Rhizobium loti hypothetical protein
FT                   Mll4416 SWALL:Q98E45 (EMBL:AP003004) (388 aa) fasta scores:
FT                   E(): 2e-42, 34.52% id in 391 aa"
FT                   /db_xref="GOA:Q7WAQ9"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAQ9"
FT                   /protein_id="CAE36612.1"
FT                   /translation="MQAMNQPQVQQYDIVIIGGGIIGSSVAYHVLARDPAARVCVVEPD
FT                   PSYEFASALRSSGGCRVQFTCPENIAMSLYSLDVIKNFENTMAANGRPAPVDWVQGGYL
FT                   FLVPPERVAMLERNVARQQAMGCQVDLLTPAELKARFPSIHVDDLGAGAHTPQDGWCDP
FT                   NGLLWGFRRKAVELGAVYLKDRVVAADVTPARARRVTLESGAQLDAEAFVNAAGAWSGQ
FT                   VAELFGMHLPVVPMRRFEHYFTCGNPIEPLPYVKDLSRLAFRSEGRGFSGGLVNGDENR
FT                   GFNFDVDHDYFENVVWPAVAHHFPPLEAAKCHRTWSGLYEQNELDGNPVIGAWNVRLKN
FT                   LYTVAGFSGHGMMHAPAAGRGIAELLVHGAFQSLDLSKLGYERVQASQPYREEGIL"
     MQAMNQPQVQ QYDIVIIGGG IIGSSVAYHV LARDPAARVC VVEPDPSYEF ASALRSSGGC        60
     RVQFTCPENI AMSLYSLDVI KNFENTMAAN GRPAPVDWVQ GGYLFLVPPE RVAMLERNVA       120
     RQQAMGCQVD LLTPAELKAR FPSIHVDDLG AGAHTPQDGW CDPNGLLWGF RRKAVELGAV       180
     YLKDRVVAAD VTPARARRVT LESGAQLDAE AFVNAAGAWS GQVAELFGMH LPVVPMRRFE       240
     HYFTCGNPIE PLPYVKDLSR LAFRSEGRGF SGGLVNGDEN RGFNFDVDHD YFENVVWPAV       300
     AHHFPPLEAA KCHRTWSGLY EQNELDGNPV IGAWNVRLKN LYTVAGFSGH GMMHAPAAGR       360
     GIAELLVHGA FQSLDLSKLG YERVQASQPY REEGIL                                 396
//

If you have problems or comments...

PBIL Back to PBIL home page