(data stored in ACNUC1104 zone)

EMBL: BX640427.PE191

BX640427.PE191       Location/Qualifiers
FT   CDS             complement(197328..197810)
FT                   /transl_table=11
FT                   /locus_tag="BPP1482"
FT                   /product="conserved hypothetical protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1370"
FT                   /db_xref="GOA:Q7WAA0"
FT                   /db_xref="InterPro:IPR007809"
FT                   /db_xref="InterPro:IPR036679"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAA0"
FT                   /protein_id="CAE36784.1"
FT                   /translation="MNSAALKSCLERENALVVEFLHALEAETEALMDRRAHESLQAAVQ
FT                   RKETLADDLAQLGAERDALLSDAGLASGPAGTDAAAAAHPELGPLWQALQANAAQAREH
FT                   NQRNGTLIAVNLRHTQESLDALRQAAGTGAAATYDAQGRGKRGYSSAASGRAIVAT"
     MNSAALKSCL ERENALVVEF LHALEAETEA LMDRRAHESL QAAVQRKETL ADDLAQLGAE        60
     RDALLSDAGL ASGPAGTDAA AAAHPELGPL WQALQANAAQ AREHNQRNGT LIAVNLRHTQ       120
     ESLDALRQAA GTGAAATYDA QGRGKRGYSS AASGRAIVAT                             160
//

If you have problems or comments...

PBIL Back to PBIL home page