(data stored in ACNUC1104 zone)

EMBL: BX640427.PE2

BX640427.PE2         Location/Qualifiers
FT   CDS             734..1345
FT                   /transl_table=11
FT                   /locus_tag="BPP1293"
FT                   /product="putative membrane transport protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2597"
FT                   /db_xref="GOA:Q7WAS5"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAS5"
FT                   /protein_id="CAE36595.1"
FT                   /translation="MSLLAFLLAAALLAITPGPGIAYVVARTVAGGRAEGLASCLGTAL
FT                   GGLVHVLAAALGLSVLIAESALAFSLLKYAGAAYLVYLGLRMWLSPRPAAVRVVAPQGA
FT                   RRALAEGVLVEALNVKTALFFLAFLPQFVDPGAPLAPQLALLGGICVTLNTLVDVMAVV
FT                   AAHRLLRSEAARVARARVLTRVSGTTMVGLGVFLALARRD"
     MSLLAFLLAA ALLAITPGPG IAYVVARTVA GGRAEGLASC LGTALGGLVH VLAAALGLSV        60
     LIAESALAFS LLKYAGAAYL VYLGLRMWLS PRPAAVRVVA PQGARRALAE GVLVEALNVK       120
     TALFFLAFLP QFVDPGAPLA PQLALLGGIC VTLNTLVDVM AVVAAHRLLR SEAARVARAR       180
     VLTRVSGTTM VGLGVFLALA RRD                                               203
//

If you have problems or comments...

PBIL Back to PBIL home page