(data stored in ACNUC1104 zone)

EMBL: BX640427.PE205

BX640427.PE205       Location/Qualifiers
FT   CDS             210020..211687
FT                   /transl_table=11
FT                   /gene="tsr"
FT                   /gene_synonym="cheD"
FT                   /locus_tag="BPP1496"
FT                   /product="methyl-accepting chemotaxis protein I"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1384"
FT                   /db_xref="GOA:Q7WA87"
FT                   /db_xref="InterPro:IPR003122"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR035440"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WA87"
FT                   /protein_id="CAE36798.1"
FT                   /translation="MARAPLEERVFDGKRINMWSNLKVRTCITLVLGLFLVAMLVSNAM
FT                   AWLGMSSSNDKLERVNNAYSNQAVPAYEAYVMLLRARLNMVSSMMDLQEGRLKESADTL
FT                   AHAQRQAGEARERFEAFLAVAKASSGADRVGAVETAFHAYLEVAARQMEAMQNQKLGEF
FT                   VQLNPSAQRLNTAFDTAASAYLDRIDTDTDALVDDARAEHLRANTVTLVLIVLALALCA
FT                   GCGVFIGRAVLRPLKEAGQHFDRIAAGDLTARVDVRSTNEIGQLFAALKRMQESLTRTV
FT                   AAVRRGVDEINVGSREISAGNTDLSSRTEEQAASLEETAASMEQLASTVKQNADNARQA
FT                   NQLAASASDVAERGGSAVSEVVTTMQDISASSRKISEIVSVIDGIAFQTNILALNAAVE
FT                   AARAGEQGKGFAVVAGEVRSLAQRSAQAAKEIKVLIEDSVDKVGTGSQQVERAGATMQE
FT                   IVASVKRVTDIMGEISAASEEQSSGIEQVNRAVSQMDEVTQQNAALVEEAAAAAGSLQE
FT                   QAQRLAEAVAVFKINTGEVIEVPAHQLSGYAAPLVAQS"
     MARAPLEERV FDGKRINMWS NLKVRTCITL VLGLFLVAML VSNAMAWLGM SSSNDKLERV        60
     NNAYSNQAVP AYEAYVMLLR ARLNMVSSMM DLQEGRLKES ADTLAHAQRQ AGEARERFEA       120
     FLAVAKASSG ADRVGAVETA FHAYLEVAAR QMEAMQNQKL GEFVQLNPSA QRLNTAFDTA       180
     ASAYLDRIDT DTDALVDDAR AEHLRANTVT LVLIVLALAL CAGCGVFIGR AVLRPLKEAG       240
     QHFDRIAAGD LTARVDVRST NEIGQLFAAL KRMQESLTRT VAAVRRGVDE INVGSREISA       300
     GNTDLSSRTE EQAASLEETA ASMEQLASTV KQNADNARQA NQLAASASDV AERGGSAVSE       360
     VVTTMQDISA SSRKISEIVS VIDGIAFQTN ILALNAAVEA ARAGEQGKGF AVVAGEVRSL       420
     AQRSAQAAKE IKVLIEDSVD KVGTGSQQVE RAGATMQEIV ASVKRVTDIM GEISAASEEQ       480
     SSGIEQVNRA VSQMDEVTQQ NAALVEEAAA AAGSLQEQAQ RLAEAVAVFK INTGEVIEVP       540
     AHQLSGYAAP LVAQS                                                        555
//

If you have problems or comments...

PBIL Back to PBIL home page