(data stored in ACNUC1104 zone)

EMBL: BX640427.PE22

BX640427.PE22        Location/Qualifiers
FT   CDS             20580..21056
FT                   /transl_table=11
FT                   /locus_tag="BPP1313"
FT                   /product="putative phage-related protein"
FT                   /note="Similar to Bacteriophage T4 hypothetical 17.1 kDa
FT                   protein in gp30-riiI intergenic region Y12g or 30.3
FT                   SWALL:Y12G_BPT4 (SWALL:P32276) (152 aa) fasta scores: E():
FT                   6.3e-07, 32.66% id in 150 aa, and to Bacteriophage RB69
FT                   Gp30.3 30.3 SWALL:CAD28421 (EMBL:AJ439452) (137 aa) fasta
FT                   scores: E(): 5.1e-06, 33.62% id in 113 aa"
FT                   /db_xref="InterPro:IPR012596"
FT                   /db_xref="InterPro:IPR012816"
FT                   /db_xref="InterPro:IPR037238"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAQ6"
FT                   /protein_id="CAE36615.1"
FT                   /translation="MNSASRLNISSTSDDWRGLALSNFPLSPFVLDGELFASVEGFIQG
FT                   IKFREDDPRRATAFLSSGWDAKHLGDTVDRSGAYWGGARIRYGSAEHHQLIERAIRARI
FT                   KQCEGLRRTLRATEGMTLVHDTGKPEAPHTSLPATVFCRILETLRREILARARP"
     MNSASRLNIS STSDDWRGLA LSNFPLSPFV LDGELFASVE GFIQGIKFRE DDPRRATAFL        60
     SSGWDAKHLG DTVDRSGAYW GGARIRYGSA EHHQLIERAI RARIKQCEGL RRTLRATEGM       120
     TLVHDTGKPE APHTSLPATV FCRILETLRR EILARARP                               158
//

If you have problems or comments...

PBIL Back to PBIL home page