(data stored in ACNUC1104 zone)

EMBL: BX640427.PE221

BX640427.PE221       Location/Qualifiers
FT   CDS             complement(225412..225807)
FT                   /transl_table=11
FT                   /locus_tag="BPP1512"
FT                   /product="hypothetical protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1405"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WA75"
FT                   /protein_id="CAE36814.1"
FT                   /translation="MTAQDQIVVLTQSDQIRSTLQELRHPDCQIVISGIDQRPWPVRIL
FT                   GPDAKDGYFFWRPLDLACPDSVMLARMADEDEPPLAFHAQTADGARIHFCVDSPVTLRF
FT                   GDGSIAVLSLFPSAVRHTCARPPQAPA"
     MTAQDQIVVL TQSDQIRSTL QELRHPDCQI VISGIDQRPW PVRILGPDAK DGYFFWRPLD        60
     LACPDSVMLA RMADEDEPPL AFHAQTADGA RIHFCVDSPV TLRFGDGSIA VLSLFPSAVR       120
     HTCARPPQAP A                                                            131
//

If you have problems or comments...

PBIL Back to PBIL home page