(data stored in ACNUC1104 zone)

EMBL: BX640427.PE223

BX640427.PE223       Location/Qualifiers
FT   CDS             complement(226128..227399)
FT                   /transl_table=11
FT                   /locus_tag="BPP1514"
FT                   /product="hypothetical protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1407"
FT                   /db_xref="InterPro:IPR021136"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WA73"
FT                   /protein_id="CAE36816.1"
FT                   /translation="MSVGPPALGSILVQRLDAVLGTTMSAQSNLVSGARPDAVAQPGEA
FT                   ARPGASQTATRDPRQAVQTGGERGARQGAAGVDAKTAAALALAARGLQTSTGTTASAPT
FT                   TLGQTARTILALLAQYPGQAPAVSARAPLWTPPAQDGASPPAGGQPAAAAPNAPAQASA
FT                   AAGGAASTPSRPEAAQAGAASARTPAQTPPATLAALAGRAVLPAAPALAQALRQTLQAS
FT                   GLFYESHLSDLAFGKRSVQQLQAEPQARLPAAGAEPAATPRAPENATPARALPAAEAAP
FT                   PGQPATHTPGAPVPGIHQDATLLVRQQLDVLANQMLAWQGQAWPGTPMEWEVAREHGDD
FT                   AAGQPGTHWATRLKLNLPRLGTVEARLNLAANQLVLHVVAPDSAAEIGAAADALRQQLS
FT                   AAGLTLTNLSVDAIGAPGFDLPEA"
     MSVGPPALGS ILVQRLDAVL GTTMSAQSNL VSGARPDAVA QPGEAARPGA SQTATRDPRQ        60
     AVQTGGERGA RQGAAGVDAK TAAALALAAR GLQTSTGTTA SAPTTLGQTA RTILALLAQY       120
     PGQAPAVSAR APLWTPPAQD GASPPAGGQP AAAAPNAPAQ ASAAAGGAAS TPSRPEAAQA       180
     GAASARTPAQ TPPATLAALA GRAVLPAAPA LAQALRQTLQ ASGLFYESHL SDLAFGKRSV       240
     QQLQAEPQAR LPAAGAEPAA TPRAPENATP ARALPAAEAA PPGQPATHTP GAPVPGIHQD       300
     ATLLVRQQLD VLANQMLAWQ GQAWPGTPME WEVAREHGDD AAGQPGTHWA TRLKLNLPRL       360
     GTVEARLNLA ANQLVLHVVA PDSAAEIGAA ADALRQQLSA AGLTLTNLSV DAIGAPGFDL       420
     PEA                                                                     423
//

If you have problems or comments...

PBIL Back to PBIL home page