(data stored in ACNUC1104 zone)

EMBL: BX640427.PE243

BX640427.PE243       Location/Qualifiers
FT   CDS             246578..247912
FT                   /transl_table=11
FT                   /locus_tag="BPP1534"
FT                   /product="putative membrane protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1426"
FT                   /db_xref="GOA:Q7WA53"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR004387"
FT                   /db_xref="InterPro:IPR008915"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="InterPro:IPR041489"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WA53"
FT                   /protein_id="CAE36836.1"
FT                   /translation="MLFTLLAFVVALGTLITFHELGHYWIARLCGVRVLRFSVGFGRVL
FT                   ARRTDRHGTEWAISAIPLGGYVKMQDDPPAGASAAEAARSFNAQPVGRRIAIVAAGPLF
FT                   NLFLAVVLYAGLNLAGTEVPAPVVGQPAAGTPAAQAGLMAGDRIEAVQGRAVDSWNDAR
FT                   WRLLDVLSSQGEAQLEVRGPGGAARGLVLQVPGGNRLDPADGDPLAETGLRLAQPKPVV
FT                   REVIAGGAGEQAGLRGGDLIVAAGQAADLDAGALVALIQRHAGQPLALTVQRGADRLTL
FT                   TVVPRAESVQGQEVGRIGVQLGGDIPMVTVRYGVIDSVWRGAQRTWDTAWLSLRMMGRM
FT                   VLGEVSWRNISGPVTIADYAGQTARIGLEAYIAYLALISISLGVLNLLPIPMLDGGHLL
FT                   YYLVEIVKGSPVSDRWIDIGQRAGIGLLAGLMGLALFNDFARLFT"
     MLFTLLAFVV ALGTLITFHE LGHYWIARLC GVRVLRFSVG FGRVLARRTD RHGTEWAISA        60
     IPLGGYVKMQ DDPPAGASAA EAARSFNAQP VGRRIAIVAA GPLFNLFLAV VLYAGLNLAG       120
     TEVPAPVVGQ PAAGTPAAQA GLMAGDRIEA VQGRAVDSWN DARWRLLDVL SSQGEAQLEV       180
     RGPGGAARGL VLQVPGGNRL DPADGDPLAE TGLRLAQPKP VVREVIAGGA GEQAGLRGGD       240
     LIVAAGQAAD LDAGALVALI QRHAGQPLAL TVQRGADRLT LTVVPRAESV QGQEVGRIGV       300
     QLGGDIPMVT VRYGVIDSVW RGAQRTWDTA WLSLRMMGRM VLGEVSWRNI SGPVTIADYA       360
     GQTARIGLEA YIAYLALISI SLGVLNLLPI PMLDGGHLLY YLVEIVKGSP VSDRWIDIGQ       420
     RAGIGLLAGL MGLALFNDFA RLFT                                              444
//

If you have problems or comments...

PBIL Back to PBIL home page