(data stored in ACNUC1104 zone)

EMBL: BX640427.PE244

BX640427.PE244       Location/Qualifiers
FT   CDS             247965..250301
FT                   /transl_table=11
FT                   /locus_tag="BPP1535"
FT                   /product="probable surface antigen"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1427"
FT                   /db_xref="GOA:Q7WA52"
FT                   /db_xref="InterPro:IPR000184"
FT                   /db_xref="InterPro:IPR010827"
FT                   /db_xref="InterPro:IPR023707"
FT                   /db_xref="InterPro:IPR034746"
FT                   /db_xref="InterPro:IPR039910"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WA52"
FT                   /protein_id="CAE36837.1"
FT                   /translation="MSLRRMFHHKKGVIPGLLAAALLAPALAHAFEPFVVRDIRVEGIQ
FT                   RTDAGTVFGYLPVKVGEKFTDEEATEAVRRLYGTGFFSDVQIQTDNNVVVVVVQERPTI
FT                   ASISFNGMREFDSKAITKSLAQVGFGEGRIFDQSMLERAEYELKEQYLAKGKYGVEVTA
FT                   TVTPLPRNRVGVSFDVFEGEVAKIREIRVVGSKAFSEGELLDQFDLTTPGWLTWYTNTD
FT                   KYSREKLEGDIERLRSFYLDQGYLEFTVEPPQVTISPDRKDIYITITVHEGEPYKVREV
FT                   KLAGNLMGLDSEINNLVEIKSGEVFSAAKANNSAKAITDYLGDLGYAFANVNPNPQLDR
FT                   AKHEADVTFYVDPSRRVYVRRIQIGGNTRTRDEVVRREMRQQEAAWYDAGDIKVSRDRV
FT                   DRLGYFNEVNVKTDPVPGSPDQVDVNVDVKEKPTGIINLGVGYGSSEKAILSAGISEDN
FT                   VFGSGTNLTLQLNTSKTNRAVVLSHTDPYFTKDGISRTTSAYYRVTEPWDNNDGDYRVK
FT                   AMGLGMNFGVPISEYDRIFLGGTFERNQIDLYNNSPQAYRDFVDQYGDSTNALIFNTGW
FT                   SKDTRDSALAPTKGAYTRLKGDFSTMDLKYYLLTAQQQYYLPLGRSYTLALNGMIDYGR
FT                   SYGGLDYPVIKNVYAGGIGTVRGYEGASLGPRDRLTGDYIGGSRRMVANAQLYLPFPGA
FT                   SKDRTLRWFVFTDAGQVAAGSGMSCTAGKPGSEVEDPCGWRFSAGIGLSWQSPLGPLQL
FT                   SYARPLNSKSGDDTQAFQFQIGTGF"
     MSLRRMFHHK KGVIPGLLAA ALLAPALAHA FEPFVVRDIR VEGIQRTDAG TVFGYLPVKV        60
     GEKFTDEEAT EAVRRLYGTG FFSDVQIQTD NNVVVVVVQE RPTIASISFN GMREFDSKAI       120
     TKSLAQVGFG EGRIFDQSML ERAEYELKEQ YLAKGKYGVE VTATVTPLPR NRVGVSFDVF       180
     EGEVAKIREI RVVGSKAFSE GELLDQFDLT TPGWLTWYTN TDKYSREKLE GDIERLRSFY       240
     LDQGYLEFTV EPPQVTISPD RKDIYITITV HEGEPYKVRE VKLAGNLMGL DSEINNLVEI       300
     KSGEVFSAAK ANNSAKAITD YLGDLGYAFA NVNPNPQLDR AKHEADVTFY VDPSRRVYVR       360
     RIQIGGNTRT RDEVVRREMR QQEAAWYDAG DIKVSRDRVD RLGYFNEVNV KTDPVPGSPD       420
     QVDVNVDVKE KPTGIINLGV GYGSSEKAIL SAGISEDNVF GSGTNLTLQL NTSKTNRAVV       480
     LSHTDPYFTK DGISRTTSAY YRVTEPWDNN DGDYRVKAMG LGMNFGVPIS EYDRIFLGGT       540
     FERNQIDLYN NSPQAYRDFV DQYGDSTNAL IFNTGWSKDT RDSALAPTKG AYTRLKGDFS       600
     TMDLKYYLLT AQQQYYLPLG RSYTLALNGM IDYGRSYGGL DYPVIKNVYA GGIGTVRGYE       660
     GASLGPRDRL TGDYIGGSRR MVANAQLYLP FPGASKDRTL RWFVFTDAGQ VAAGSGMSCT       720
     AGKPGSEVED PCGWRFSAGI GLSWQSPLGP LQLSYARPLN SKSGDDTQAF QFQIGTGF         778
//

If you have problems or comments...

PBIL Back to PBIL home page