(data stored in ACNUC1104 zone)

EMBL: BX640427.PE245

BX640427.PE245       Location/Qualifiers
FT   CDS             250379..250990
FT                   /transl_table=11
FT                   /locus_tag="BPP1536"
FT                   /product="putative outer membrane protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1428"
FT                   /db_xref="GOA:Q7WA51"
FT                   /db_xref="InterPro:IPR005632"
FT                   /db_xref="InterPro:IPR024930"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WA51"
FT                   /protein_id="CAE36838.1"
FT                   /translation="MAQYRLCFTSLEGEIFMMSDFALNTSGSKRAKRGAGKLGVSLALA
FT                   GALLFGSSAAVTAQAQGTKIGFVNTERILRESGPAKAAQSKIESEFKRRDDELQRLSSS
FT                   LRSQAEKFDKDAPVLSESDRVKRQRELSNLDMDLQRKRREFQEDFNRRRNEEFSSIVTK
FT                   ANDAIKRIAEQENYDLIIQDAVTVNPRIDITDKVIQSLGR"
     MAQYRLCFTS LEGEIFMMSD FALNTSGSKR AKRGAGKLGV SLALAGALLF GSSAAVTAQA        60
     QGTKIGFVNT ERILRESGPA KAAQSKIESE FKRRDDELQR LSSSLRSQAE KFDKDAPVLS       120
     ESDRVKRQRE LSNLDMDLQR KRREFQEDFN RRRNEEFSSI VTKANDAIKR IAEQENYDLI       180
     IQDAVTVNPR IDITDKVIQS LGR                                               203
//

If you have problems or comments...

PBIL Back to PBIL home page