(data stored in ACNUC1104 zone)

EMBL: BX640427.PE25

BX640427.PE25        Location/Qualifiers
FT   CDS             complement(23678..24817)
FT                   /transl_table=11
FT                   /locus_tag="BPP1316"
FT                   /product="putative membrane protein"
FT                   /note="Similar to Rhizobium meliloti putative ABC
FT                   transporter permease protein Rb0871 or Smb21205
FT                   SWALL:Q92V46 (EMBL:AL603645) (384 aa) fasta scores: E():
FT                   3.7e-57, 45.23% id in 367 aa, and to uncultured bacterium
FT                   pCosFS1 ElsD SWALL:Q9APR7 (EMBL:AF250767) (384 aa) fasta
FT                   scores: E(): 2.4e-50, 40.1% id in 374 aa"
FT                   /db_xref="GOA:Q7WAQ5"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAQ5"
FT                   /protein_id="CAE36618.1"
FT                   /translation="MSPRAGAGGFWPRLASLVRKEFRQLLRDRSNLAIGLVLPILLILI
FT                   FGYGLSLDLRNAPIAVVLEDRSPQARDALAGLAGSDYLAPVWLADMHSAETLMRRHEVE
FT                   GIVRVPADFARRLAAGDAQVQLLLHGADANSAAALARYVDGALGHAARLRADRAGHAAP
FT                   PPGVTMVERLWFNAANTSTWYLVPGLIALIMTLVGAFLTALVVAREWERGTLEALFVTP
FT                   VRPTEILLAKMIPYFVVGMLELGLCLAAARLLFHVPLQGSLAVLLLSAMLYLVVALGIG
FT                   LLISATTRNQFLASQVAVLSSFLPALMLSGFLFDLRNVPAAIRFVGSLLPATYFMELVK
FT                   TAFLAGDNWPLIARNCAILAVYAVALLALARRLTRKSLD"
     MSPRAGAGGF WPRLASLVRK EFRQLLRDRS NLAIGLVLPI LLILIFGYGL SLDLRNAPIA        60
     VVLEDRSPQA RDALAGLAGS DYLAPVWLAD MHSAETLMRR HEVEGIVRVP ADFARRLAAG       120
     DAQVQLLLHG ADANSAAALA RYVDGALGHA ARLRADRAGH AAPPPGVTMV ERLWFNAANT       180
     STWYLVPGLI ALIMTLVGAF LTALVVAREW ERGTLEALFV TPVRPTEILL AKMIPYFVVG       240
     MLELGLCLAA ARLLFHVPLQ GSLAVLLLSA MLYLVVALGI GLLISATTRN QFLASQVAVL       300
     SSFLPALMLS GFLFDLRNVP AAIRFVGSLL PATYFMELVK TAFLAGDNWP LIARNCAILA       360
     VYAVALLALA RRLTRKSLD                                                    379
//

If you have problems or comments...

PBIL Back to PBIL home page