(data stored in ACNUC1104 zone)

EMBL: BX640427.PE252

BX640427.PE252       Location/Qualifiers
FT   CDS             complement(255964..256791)
FT                   /transl_table=11
FT                   /locus_tag="BPP1543"
FT                   /product="conserved hypothetical protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1435"
FT                   /db_xref="GOA:Q7WA44"
FT                   /db_xref="InterPro:IPR005177"
FT                   /db_xref="InterPro:IPR026530"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7WA44"
FT                   /protein_id="CAE36845.1"
FT                   /translation="MTSTPIERAVYIVSDSTGITAETFSHSVLSQFDEVNFKPVRLPFI
FT                   DTLDKAREVVARINRNALEAGVPPIVFSTLVNPEILALVRQSNGVFLDLFGTFVSHIEQ
FT                   ALGLKSSHSIGRSHMAANSEKYRNRIDAINFSLAHDDGQFVNQLDQADVILVGVSRCGK
FT                   TPTSLYLAMQYAVKAANFPLTPDDFERGALPKTIAPYRGKLFGLSIQPERLAEVRNERR
FT                   PNSHYARLEQCRYEVAEAERMMRREGISWLSTTTKSIEEIATTVLQEVGLERV"
     MTSTPIERAV YIVSDSTGIT AETFSHSVLS QFDEVNFKPV RLPFIDTLDK AREVVARINR        60
     NALEAGVPPI VFSTLVNPEI LALVRQSNGV FLDLFGTFVS HIEQALGLKS SHSIGRSHMA       120
     ANSEKYRNRI DAINFSLAHD DGQFVNQLDQ ADVILVGVSR CGKTPTSLYL AMQYAVKAAN       180
     FPLTPDDFER GALPKTIAPY RGKLFGLSIQ PERLAEVRNE RRPNSHYARL EQCRYEVAEA       240
     ERMMRREGIS WLSTTTKSIE EIATTVLQEV GLERV                                  275
//

If you have problems or comments...

PBIL Back to PBIL home page