(data stored in ACNUC1104 zone)

EMBL: BX640427.PE256

BX640427.PE256       Location/Qualifiers
FT   CDS             260698..261624
FT                   /transl_table=11
FT                   /locus_tag="BPP1547"
FT                   /product="putative membrane protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1440"
FT                   /db_xref="GOA:Q7WA42"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR001972"
FT                   /db_xref="InterPro:IPR032435"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WA42"
FT                   /protein_id="CAE36849.1"
FT                   /translation="MIDVSTVVLIVIVILALMIVVKAIAIVPQQHAWVVERLGKFDRVL
FT                   SPGAGFVIPFIERVSYKHSLKEIPLDVPSQVCITRDNTQLQVDGVLYFQVTDPMRASYG
FT                   SSNYISAITQLAQTTLRSVIGKLELDRTFEEREFINSTIVASLDEAALNWGVKVLRYEI
FT                   KDLTPPNEILRAMQAQITAEREKRALIAASEGRRQEQINIATGEREAAIARSEGEKQAQ
FT                   INQAQGEAAAVLAIAEATAKAIEQVGEAVRQPGGMEAVNLKVAERYVDAFSNVAKEGNT
FT                   LILPSNLSDVGGLIASAMTIVKSTKSA"
     MIDVSTVVLI VIVILALMIV VKAIAIVPQQ HAWVVERLGK FDRVLSPGAG FVIPFIERVS        60
     YKHSLKEIPL DVPSQVCITR DNTQLQVDGV LYFQVTDPMR ASYGSSNYIS AITQLAQTTL       120
     RSVIGKLELD RTFEEREFIN STIVASLDEA ALNWGVKVLR YEIKDLTPPN EILRAMQAQI       180
     TAEREKRALI AASEGRRQEQ INIATGEREA AIARSEGEKQ AQINQAQGEA AAVLAIAEAT       240
     AKAIEQVGEA VRQPGGMEAV NLKVAERYVD AFSNVAKEGN TLILPSNLSD VGGLIASAMT       300
     IVKSTKSA                                                                308
//

If you have problems or comments...

PBIL Back to PBIL home page