(data stored in ACNUC1104 zone)

EMBL: BX640427.PE259

BX640427.PE259       Location/Qualifiers
FT   CDS             263356..263790
FT                   /transl_table=11
FT                   /locus_tag="BPP1550"
FT                   /product="conserved hypothetical protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1443"
FT                   /db_xref="InterPro:IPR005031"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WA40"
FT                   /protein_id="CAE36852.1"
FT                   /translation="MHKVQRSVLVPYSAAQMFDLVADVEKYPEFMPWCGGAEVHSRSEH
FT                   GMQASILISFAGLKQRFSTRNTHDYPQRIDLELVDGPFSMLVGHWVFQPLAEDACKVLF
FT                   TLEYAFSNRALEMVVGPVFNRIAASFIDSFTKRAQAKYGE"
     MHKVQRSVLV PYSAAQMFDL VADVEKYPEF MPWCGGAEVH SRSEHGMQAS ILISFAGLKQ        60
     RFSTRNTHDY PQRIDLELVD GPFSMLVGHW VFQPLAEDAC KVLFTLEYAF SNRALEMVVG       120
     PVFNRIAASF IDSFTKRAQA KYGE                                              144
//

If you have problems or comments...

PBIL Back to PBIL home page