(data stored in ACNUC1104 zone)

EMBL: BX640427.PE260

BX640427.PE260       Location/Qualifiers
FT   CDS             263780..264130
FT                   /transl_table=11
FT                   /locus_tag="BPP1551"
FT                   /product="conserved hypothetical protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1444"
FT                   /db_xref="InterPro:IPR005346"
FT                   /db_xref="InterPro:IPR016155"
FT                   /db_xref="InterPro:IPR037021"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WA39"
FT                   /protein_id="CAE36853.1"
FT                   /translation="MANDTPAPAGSLRVTVCHACPDGAWQRAVTLPAGATVADAVAASG
FT                   FAAAHRGQDPWAHGVGVFGKAQAADAPLADGDRVEIYRGLSFDPKESRRRRAEHRRALA
FT                   ARGGKARPAGLL"
     MANDTPAPAG SLRVTVCHAC PDGAWQRAVT LPAGATVADA VAASGFAAAH RGQDPWAHGV        60
     GVFGKAQAAD APLADGDRVE IYRGLSFDPK ESRRRRAEHR RALAARGGKA RPAGLL           116
//

If you have problems or comments...

PBIL Back to PBIL home page