(data stored in ACNUC1104 zone)

EMBL: BX640427.PE264

BX640427.PE264       Location/Qualifiers
FT   CDS             267637..268074
FT                   /transl_table=11
FT                   /locus_tag="BPP1555"
FT                   /product="conserved hypothetical protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1448"
FT                   /db_xref="InterPro:IPR003736"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WA35"
FT                   /protein_id="CAE36857.1"
FT                   /translation="MPDTEAFEAARQRVHDNFARQSVMALIGARLGAVEPGEVEIALPY
FT                   RADLCQQNGFLHAGISTTIADSAGGYAAYTLFGPGEDVLTSEFKMNFLAPADGEHFVAS
FT                   GKVLKPGRRLSICQVELRACRGERSTLCLVGLMTAVRVTPR"
     MPDTEAFEAA RQRVHDNFAR QSVMALIGAR LGAVEPGEVE IALPYRADLC QQNGFLHAGI        60
     STTIADSAGG YAAYTLFGPG EDVLTSEFKM NFLAPADGEH FVASGKVLKP GRRLSICQVE       120
     LRACRGERST LCLVGLMTAV RVTPR                                             145
//

If you have problems or comments...

PBIL Back to PBIL home page