(data stored in ACNUC1104 zone)

EMBL: BX640427.PE265

BX640427.PE265       Location/Qualifiers
FT   CDS             268134..268823
FT                   /transl_table=11
FT                   /locus_tag="BPP1556"
FT                   /product="putative membrane protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1449"
FT                   /db_xref="GOA:Q7WA34"
FT                   /db_xref="InterPro:IPR008217"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WA34"
FT                   /protein_id="CAE36858.1"
FT                   /translation="MPARSHHRIFRSGWLRAAVLGANDGIVSTASLIAGVAAAQASHAA
FT                   ILTSGLAGLVAGALSMAAGEYVSVKSQADIEAADLRLEQSSLKRNSREELEELTGIYVE
FT                   RGLSPDLAGQVARQLTRHNALDAHARDELGISVHNRAQPVQAALASAASFAVGAALPLA
FT                   IAMAAPLAQLMPVVIAGSVAGLGILGAVAARAGGAPVGPAAVRVVLLGAAAMALTAGVG
FT                   ALFGVAV"
     MPARSHHRIF RSGWLRAAVL GANDGIVSTA SLIAGVAAAQ ASHAAILTSG LAGLVAGALS        60
     MAAGEYVSVK SQADIEAADL RLEQSSLKRN SREELEELTG IYVERGLSPD LAGQVARQLT       120
     RHNALDAHAR DELGISVHNR AQPVQAALAS AASFAVGAAL PLAIAMAAPL AQLMPVVIAG       180
     SVAGLGILGA VAARAGGAPV GPAAVRVVLL GAAAMALTAG VGALFGVAV                   229
//

If you have problems or comments...

PBIL Back to PBIL home page