(data stored in ACNUC1104 zone)

EMBL: BX640427.PE267

BX640427.PE267       Location/Qualifiers
FT   CDS             270016..271062
FT                   /transl_table=11
FT                   /locus_tag="BPP1558"
FT                   /product="putative exported protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1846"
FT                   /db_xref="GOA:Q7WA32"
FT                   /db_xref="InterPro:IPR003770"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WA32"
FT                   /protein_id="CAE36860.1"
FT                   /translation="MRTLMRKRIRFYFLLLVLVALLGAALAAGGAWTWMHRPVALKSDR
FT                   IDFVVDPGSTPRAIARTLNQAGVAVWEPGFVWMARLSELDKQIKAGGYQAIDGDSPWQL
FT                   LQRLARGDMSQRQITFLEGWMFRQMRQALREHPDVKQTLGETSDEALMERLGSTVTHPE
FT                   GMFFPDTYVFTPGSTDFDILRRAYQEGQRILESTWAKRQDGLPVGTPYEALILASIVEK
FT                   ETGHGPERARVAGVFANRLRIGMLLQTDPTVIYGMGEAYQGRIRKRDLQTDTPWNTYTR
FT                   PGLPPTPIAAPGRAALLAAVQPERHKYLFFVSRGNGTSEFSVNLNDHNRNVSRYILGQG
FT                   QPQQGSQQ"
     MRTLMRKRIR FYFLLLVLVA LLGAALAAGG AWTWMHRPVA LKSDRIDFVV DPGSTPRAIA        60
     RTLNQAGVAV WEPGFVWMAR LSELDKQIKA GGYQAIDGDS PWQLLQRLAR GDMSQRQITF       120
     LEGWMFRQMR QALREHPDVK QTLGETSDEA LMERLGSTVT HPEGMFFPDT YVFTPGSTDF       180
     DILRRAYQEG QRILESTWAK RQDGLPVGTP YEALILASIV EKETGHGPER ARVAGVFANR       240
     LRIGMLLQTD PTVIYGMGEA YQGRIRKRDL QTDTPWNTYT RPGLPPTPIA APGRAALLAA       300
     VQPERHKYLF FVSRGNGTSE FSVNLNDHNR NVSRYILGQG QPQQGSQQ                    348
//

If you have problems or comments...

PBIL Back to PBIL home page