(data stored in ACNUC1104 zone)

EMBL: BX640427.PE270

BX640427.PE270       Location/Qualifiers
FT   CDS             272775..273554
FT                   /transl_table=11
FT                   /locus_tag="BPP1561"
FT                   /product="conserved hypothetical protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1849"
FT                   /db_xref="GOA:Q7WA29"
FT                   /db_xref="InterPro:IPR001130"
FT                   /db_xref="InterPro:IPR015991"
FT                   /db_xref="InterPro:IPR018228"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WA29"
FT                   /protein_id="CAE36863.1"
FT                   /translation="MVRMYVDSHCHLNFPELAQDLPAVLDRMAANQVTHALVVSVNMPD
FT                   WPGLMQLVEPHGNLWASVGVHPDYEDTPDPEPAELERLAAHPKVVAIGETGLDYYRLSE
FT                   PLDWQRERFRRHIRAARSTGLPLIVHTRASAQDTVRLLREEGADEVGGVMHCFTESWEI
FT                   AQQAMALNFHISLSGIVTFKNAQLVHEVAANMPLDRLLIETDSPYLAPVPYRGKLNDPS
FT                   KVIHVAEKIAELKGIPVAEVAHASTENFFKLFNKIKR"
     MVRMYVDSHC HLNFPELAQD LPAVLDRMAA NQVTHALVVS VNMPDWPGLM QLVEPHGNLW        60
     ASVGVHPDYE DTPDPEPAEL ERLAAHPKVV AIGETGLDYY RLSEPLDWQR ERFRRHIRAA       120
     RSTGLPLIVH TRASAQDTVR LLREEGADEV GGVMHCFTES WEIAQQAMAL NFHISLSGIV       180
     TFKNAQLVHE VAANMPLDRL LIETDSPYLA PVPYRGKLND PSKVIHVAEK IAELKGIPVA       240
     EVAHASTENF FKLFNKIKR                                                    259
//

If you have problems or comments...

PBIL Back to PBIL home page