(data stored in ACNUC1104 zone)

EMBL: BX640427.PE28

BX640427.PE28        Location/Qualifiers
FT   CDS             27692..28339
FT                   /transl_table=11
FT                   /locus_tag="BPP1319"
FT                   /product="putative TetR-family transcriptional regulator"
FT                   /note="Similar to Pseudomonas fluorescens PhlH SWALL:Q9RF00
FT                   (EMBL:AF207529) (223 aa) fasta scores: E(): 5e-29, 43.75%
FT                   id in 208 aa, and to Rhizobium meliloti putative
FT                   transcriptional regulator, TetR family protein Rb0874 or
FT                   Smb21208 SWALL:Q92V43 (EMBL:AL603645) (225 aa) fasta
FT                   scores: E(): 6.7e-05, 25.11% id in 227 aa"
FT                   /db_xref="GOA:Q7WAQ3"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR015292"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAQ3"
FT                   /protein_id="CAE36621.1"
FT                   /translation="MTRPRRSLRADGASTRARILEAAGQLFGQYGYAGVASKAICAAAG
FT                   ADLAAINYHFGSRDGLYRAVLVEGHKHFINLDTLTALTQSDLSPREKLCAFIDGMVAGL
FT                   WEQDWHTRVCAREVLAPSAHFAALIDEEVLPKFRLVAGILGDITGFAPGDPALARCAVS
FT                   IVAPCMMLMVVDRNAPSPPQQVLAQPAADLAEHLKRFALAGLDAVSAAAPRR"
     MTRPRRSLRA DGASTRARIL EAAGQLFGQY GYAGVASKAI CAAAGADLAA INYHFGSRDG        60
     LYRAVLVEGH KHFINLDTLT ALTQSDLSPR EKLCAFIDGM VAGLWEQDWH TRVCAREVLA       120
     PSAHFAALID EEVLPKFRLV AGILGDITGF APGDPALARC AVSIVAPCMM LMVVDRNAPS       180
     PPQQVLAQPA ADLAEHLKRF ALAGLDAVSA AAPRR                                  215
//

If you have problems or comments...

PBIL Back to PBIL home page