(data stored in ACNUC1104 zone)

EMBL: BX640427.PE283

BX640427.PE283       Location/Qualifiers
FT   CDS             complement(286879..287361)
FT                   /transl_table=11
FT                   /locus_tag="BPP1574"
FT                   /product="putative membrane protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1863"
FT                   /db_xref="GOA:Q7WA20"
FT                   /db_xref="InterPro:IPR007387"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WA20"
FT                   /protein_id="CAE36876.1"
FT                   /translation="MLGRISHALSGLSKAIAALAVALLAALITYVVFERFVMHTTPHWA
FT                   EELPRLVLVWAAFIGGVTCSHERTHLMAGLLPFVVRNPRALAICDRVNQALIIVGLAAL
FT                   GYAGWQLAELTMDQTLPALDVSAGTVYLALPVACAITIVVHLAQLFQPADPVAAKD"
     MLGRISHALS GLSKAIAALA VALLAALITY VVFERFVMHT TPHWAEELPR LVLVWAAFIG        60
     GVTCSHERTH LMAGLLPFVV RNPRALAICD RVNQALIIVG LAALGYAGWQ LAELTMDQTL       120
     PALDVSAGTV YLALPVACAI TIVVHLAQLF QPADPVAAKD                             160
//

If you have problems or comments...

PBIL Back to PBIL home page