(data stored in ACNUC1104 zone)

EMBL: BX640427.PE286

BX640427.PE286       Location/Qualifiers
FT   CDS             complement(289355..289738)
FT                   /transl_table=11
FT                   /locus_tag="BPP1577"
FT                   /product="conserved hypothetical protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1867"
FT                   /db_xref="InterPro:IPR007438"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WA18"
FT                   /protein_id="CAE36879.1"
FT                   /translation="MKPAIHLKRAYEAAAPADGRRVLIDGLWPRGLRKDALPLDDWIKD
FT                   LAPSAALRQWFGHQTPRWPAFRERYLAELRGPSHQAQLRALLAQAGAGPLTLVYGARDT
FT                   EHNNAVVLREALLALAAGGRGAA"
     MKPAIHLKRA YEAAAPADGR RVLIDGLWPR GLRKDALPLD DWIKDLAPSA ALRQWFGHQT        60
     PRWPAFRERY LAELRGPSHQ AQLRALLAQA GAGPLTLVYG ARDTEHNNAV VLREALLALA       120
     AGGRGAA                                                                 127
//

If you have problems or comments...

PBIL Back to PBIL home page