(data stored in ACNUC1104 zone)

EMBL: BX640427.PE29

BX640427.PE29        Location/Qualifiers
FT   CDS             28399..30159
FT                   /transl_table=11
FT                   /locus_tag="BPP1320"
FT                   /product="hypothetical protein"
FT                   /note="No significant database matches"
FT                   /db_xref="InterPro:IPR038607"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAQ2"
FT                   /protein_id="CAE36622.1"
FT                   /translation="MAKEAYTVGPVLSFRGVGGARQWRVSALIGVPRTAKAPALRVEGR
FT                   ACAAPVVLHQTARETFLRYDLSCDMQARERKVEFGPRGGPAWHFTVPAKGAAPRLAYVS
FT                   CNGFSDPSGMRKLVRPENAVWADLLCNHDRDLRPADYLLDKEQLWHETRTHDEGLQRFH
FT                   LLLMGGDQIYFDSIWEYIAALKQWVGLARAQQLEFKVSQALEDEIEAYYFGLYSRRWLP
FT                   PSRAPWAGAQPSLDAADAMARVPTIMMWDDHDIFDGWGSYSPAMQRCELFQTLFRHARR
FT                   AFWVFQMQHALADLPPLQAIARANVLPQDPQYEGIAWSRQLKRDRLALPLLDGQPGFTS
FT                   AYRLGPLALVAADLRTERSRTQILGTQAWTALQGWLHGLKGNRPASATGGCRHLIFMSS
FT                   VPVAHLKLSLAEGLLDTFGQDHVLDSNADDLKDHWSHDDHEGERKRLLETLMQVANEKL
FT                   LRVSIASGDVHVAAWGNAYRRDIPPTSNWAQIQQFTSSAVVHPSLLGVAERLFLFMLNG
FT                   TAAQAQPIDVNLSVEMMLFPGHNRYVMPARNWLAFELDAGKAGKLWASWRCETETGFSN
FT                   HLQAVQPAQG"
     MAKEAYTVGP VLSFRGVGGA RQWRVSALIG VPRTAKAPAL RVEGRACAAP VVLHQTARET        60
     FLRYDLSCDM QARERKVEFG PRGGPAWHFT VPAKGAAPRL AYVSCNGFSD PSGMRKLVRP       120
     ENAVWADLLC NHDRDLRPAD YLLDKEQLWH ETRTHDEGLQ RFHLLLMGGD QIYFDSIWEY       180
     IAALKQWVGL ARAQQLEFKV SQALEDEIEA YYFGLYSRRW LPPSRAPWAG AQPSLDAADA       240
     MARVPTIMMW DDHDIFDGWG SYSPAMQRCE LFQTLFRHAR RAFWVFQMQH ALADLPPLQA       300
     IARANVLPQD PQYEGIAWSR QLKRDRLALP LLDGQPGFTS AYRLGPLALV AADLRTERSR       360
     TQILGTQAWT ALQGWLHGLK GNRPASATGG CRHLIFMSSV PVAHLKLSLA EGLLDTFGQD       420
     HVLDSNADDL KDHWSHDDHE GERKRLLETL MQVANEKLLR VSIASGDVHV AAWGNAYRRD       480
     IPPTSNWAQI QQFTSSAVVH PSLLGVAERL FLFMLNGTAA QAQPIDVNLS VEMMLFPGHN       540
     RYVMPARNWL AFELDAGKAG KLWASWRCET ETGFSNHLQA VQPAQG                      586
//

If you have problems or comments...

PBIL Back to PBIL home page