(data stored in ACNUC1104 zone)

EMBL: BX640427.PE290

BX640427.PE290       Location/Qualifiers
FT   CDS             complement(293886..295619)
FT                   /transl_table=11
FT                   /locus_tag="BPP1582"
FT                   /product="putative membrane protein"
FT                   /note="Similar to Pseudomonas aeruginosa hypothetical
FT                   protein Pa3465 SWALL:Q9HYE1 (EMBL:AE004767) (571 aa) fasta
FT                   scores: E(): 1e-126, 60.62% id in 574 aa, and to Rhizobium
FT                   meliloti putative transport transmembrane protein R00235 or
FT                   Smc02910 SWALL:Q92SW7 (EMBL:AL591783) (551 aa) fasta
FT                   scores: E(): 5.8e-68, 38.94% id in 529 aa"
FT                   /db_xref="GOA:Q7WA15"
FT                   /db_xref="InterPro:IPR010290"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WA15"
FT                   /protein_id="CAE36883.1"
FT                   /translation="MLQAPASAPEDLPRASAEAAPPPSRPGVLAPFGYPAFRMIWIANL
FT                   FANLGIWAQSVAAAWIVTEAQSGPLIVAMIQVAAALPLVALSIVTGVVADNHDRRKVML
FT                   VGMGLELVVGTLITALAFLGLLHPVTLIVAVFVVSIGSAIVTPAWQAAVSEQVPRQYVG
FT                   NAVLLNSVNYNVARAIGPAIGGVLLGALGAPWVFLLNCFCYGALIWAIWRWRRETPPRT
FT                   LPPERIYEGVVAALRFTEYSNVTRLVMMRAFSFGLSASALWALLPVLAHEHDNGSASLY
FT                   GYMLGALGLGAIAGSLGIRTVQRRLGVSRLISVAAALLALGLIALGVTENLWVVFPALL
FT                   LSGSCWIAVLATYNATVQLLVPDWVKARALTLYQTAIFGGLALGSFIWGHFAGSMGTRG
FT                   AMAAAGVALLFTVALLYRSRLPDHVDDKCLSVLPRAALPAGQSDFDARHGVVLVSIEYR
FT                   IAAERARAFIDAAGPLRLMRMRNGADQWQLFRDLEDAERWSEMFVVDSWLQYLRMNDRM
FT                   TLADKMAIDAAQAFHSGPNPPQVTHAVSYISVSAAGGRGHAAPPAPAGPAQAAMGPVTA
FT                   D"
     MLQAPASAPE DLPRASAEAA PPPSRPGVLA PFGYPAFRMI WIANLFANLG IWAQSVAAAW        60
     IVTEAQSGPL IVAMIQVAAA LPLVALSIVT GVVADNHDRR KVMLVGMGLE LVVGTLITAL       120
     AFLGLLHPVT LIVAVFVVSI GSAIVTPAWQ AAVSEQVPRQ YVGNAVLLNS VNYNVARAIG       180
     PAIGGVLLGA LGAPWVFLLN CFCYGALIWA IWRWRRETPP RTLPPERIYE GVVAALRFTE       240
     YSNVTRLVMM RAFSFGLSAS ALWALLPVLA HEHDNGSASL YGYMLGALGL GAIAGSLGIR       300
     TVQRRLGVSR LISVAAALLA LGLIALGVTE NLWVVFPALL LSGSCWIAVL ATYNATVQLL       360
     VPDWVKARAL TLYQTAIFGG LALGSFIWGH FAGSMGTRGA MAAAGVALLF TVALLYRSRL       420
     PDHVDDKCLS VLPRAALPAG QSDFDARHGV VLVSIEYRIA AERARAFIDA AGPLRLMRMR       480
     NGADQWQLFR DLEDAERWSE MFVVDSWLQY LRMNDRMTLA DKMAIDAAQA FHSGPNPPQV       540
     THAVSYISVS AAGGRGHAAP PAPAGPAQAA MGPVTAD                                577
//

If you have problems or comments...

PBIL Back to PBIL home page