(data stored in ACNUC1104 zone)

EMBL: BX640427.PE291

BX640427.PE291       Location/Qualifiers
FT   CDS             295810..297354
FT                   /transl_table=11
FT                   /locus_tag="BPP1583"
FT                   /product="putative membrane protein"
FT                   /note="Similar to Ralstonia solanacearum probable
FT                   transmembrane protein Rsp1524 or Rs04801 SWALL:Q8XPW2
FT                   (EMBL:AL646085) (505 aa) fasta scores: E(): 5.5e-61, 39.96%
FT                   id in 498 aa, and to Rhizobium loti two-component system
FT                   histidine protein kinase Mll4698 SWALL:Q98DH8
FT                   (EMBL:AP003004) (535 aa) fasta scores: E(): 7.2e-20, 28.91%
FT                   id in 505 aa"
FT                   /db_xref="GOA:Q7WA14"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR033479"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WA14"
FT                   /protein_id="CAE36884.1"
FT                   /translation="MALSRPARLLSRIGMVTALGIVAALGIVIAVASILAQDRQQVWER
FT                   EARSARNVLQALAGEFERTVTAYDLVIRGVIGDLAQPAVAAMGPEALHRLLFQQGARPD
FT                   NLAVLLVLDERGEVILDSRTAVVAPRNRSRRDYFQAHVDNPQAGLFISKPYRSRNRNGE
FT                   LSIALSRRLAHPDGSFAGVVVAAVSLSYFRDRVVQLNVGPRGSMTLFRDDGIVISRKPY
FT                   VEAQIGVDLSESANVSRFPREGRGAFVGTAILDGVERLYQFERVGKLPLIMVVALSTDD
FT                   MMTPWRRHAWVLAGAVLLLCALLVALLAALERELRRRRNAEAELAQLARIDTLSGLLNR
FT                   RAFAQVLALEWEAALRGRTPLALLLVDVDHFKAYYDCYGRSASDVLLRRVADAVRDCVP
FT                   YAANVVARHGADEFVVLLPGMGLRSAAWLAERVRARVLGLAVPHRGNRGGVVSVSIGCT
FT                   AMTPLAGSEAAVLVERADAALYLAKSRGRNRVERIGDPSTAGQGAEREMAQEPGGS"
     MALSRPARLL SRIGMVTALG IVAALGIVIA VASILAQDRQ QVWEREARSA RNVLQALAGE        60
     FERTVTAYDL VIRGVIGDLA QPAVAAMGPE ALHRLLFQQG ARPDNLAVLL VLDERGEVIL       120
     DSRTAVVAPR NRSRRDYFQA HVDNPQAGLF ISKPYRSRNR NGELSIALSR RLAHPDGSFA       180
     GVVVAAVSLS YFRDRVVQLN VGPRGSMTLF RDDGIVISRK PYVEAQIGVD LSESANVSRF       240
     PREGRGAFVG TAILDGVERL YQFERVGKLP LIMVVALSTD DMMTPWRRHA WVLAGAVLLL       300
     CALLVALLAA LERELRRRRN AEAELAQLAR IDTLSGLLNR RAFAQVLALE WEAALRGRTP       360
     LALLLVDVDH FKAYYDCYGR SASDVLLRRV ADAVRDCVPY AANVVARHGA DEFVVLLPGM       420
     GLRSAAWLAE RVRARVLGLA VPHRGNRGGV VSVSIGCTAM TPLAGSEAAV LVERADAALY       480
     LAKSRGRNRV ERIGDPSTAG QGAEREMAQE PGGS                                   514
//

If you have problems or comments...

PBIL Back to PBIL home page