(data stored in ACNUC1104 zone)

EMBL: BX640427.PE293

BX640427.PE293       Location/Qualifiers
FT   CDS             298015..298806
FT                   /transl_table=11
FT                   /locus_tag="BPP1585"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Rhizobium loti hypothetical protein
FT                   Mlr0408 SWALL:Q98MW6 (EMBL:AP002994) (257 aa) fasta scores:
FT                   E(): 4.9e-19, 44.04% id in 252 aa, and to Agrobacterium
FT                   tumefaciens transcriptional regulator PrtR or atu1484 or
FT                   agr_c_2736 SWALL:Q8UFB4 (EMBL:AE009107) (258 aa) fasta
FT                   scores: E(): 0.0097, 28.4% id in 264 aa"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WA12"
FT                   /protein_id="CAE36886.1"
FT                   /translation="MTEIDLNAYVDGQLDPARRIEVEDFLSRHPEEAMRVMADLRQRDA
FT                   LRWALGASQQAPADGADTPTAVHTRRLARRLERGLVRRGLDDRLRQAAAAVLLVAVGWA
FT                   GHVGYAARYPDMRHVVAATAPSFVEDAVQAHRTAKVRAAMASQPRVPHLDADELLRATG
FT                   VRVPALPASWAVRDVQVFPGRTGPSVEMEVEAAGLGRLWVFAAREPAHAAEAAPVVSRF
FT                   QDAPIAYWQQGQWAYAITGDLPDAELGRAAGQMTVAMLATP"
     MTEIDLNAYV DGQLDPARRI EVEDFLSRHP EEAMRVMADL RQRDALRWAL GASQQAPADG        60
     ADTPTAVHTR RLARRLERGL VRRGLDDRLR QAAAAVLLVA VGWAGHVGYA ARYPDMRHVV       120
     AATAPSFVED AVQAHRTAKV RAAMASQPRV PHLDADELLR ATGVRVPALP ASWAVRDVQV       180
     FPGRTGPSVE MEVEAAGLGR LWVFAAREPA HAAEAAPVVS RFQDAPIAYW QQGQWAYAIT       240
     GDLPDAELGR AAGQMTVAML ATP                                               263
//

If you have problems or comments...

PBIL Back to PBIL home page