(data stored in ACNUC1104 zone)

EMBL: BX640427.PE294

BX640427.PE294       Location/Qualifiers
FT   CDS             298895..299614
FT                   /transl_table=11
FT                   /locus_tag="BPP1586"
FT                   /product="putative membrane protein"
FT                   /note="Similar to Pseudomonas aeruginosa hypothetical
FT                   protein Pa1170 SWALL:Q9I4G7 (EMBL:AE004547) (244 aa) fasta
FT                   scores: E(): 2.3e-41, 52.54% id in 236 aa, and to Ralstonia
FT                   solanacearum hypothetical transmembrane protein Rsc0556 or
FT                   Rs04909 SWALL:Q8Y1Y1 (EMBL:AL646060) (232 aa) fasta scores:
FT                   E(): 1.7e-33, 48.85% id in 219 aa"
FT                   /db_xref="GOA:Q7WA11"
FT                   /db_xref="InterPro:IPR005496"
FT                   /db_xref="InterPro:IPR022301"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WA11"
FT                   /protein_id="CAE36887.1"
FT                   /translation="MLEFFQTLSWAAVFQIILIDILLGGDNAVVIALACRNLEPKQRMQ
FT                   GILWGTAGAIGLRVVLIAFALTLLTVPYLKIVGALLLWVGVKLLIPEDDAHGNIKGGTS
FT                   IAAAVKTIIIADFVMSLDNVIAIAGAAQGAAQEHQLGLVIFGLVVSVPIIIWGSTLVLK
FT                   LIDRFPMVVTFGAALLGWIAGGMLVTDVVVVERFGEVSGVAKIAAEVAGALLIVGLGRW
FT                   FARRKAAAAPQTARESA"
     MLEFFQTLSW AAVFQIILID ILLGGDNAVV IALACRNLEP KQRMQGILWG TAGAIGLRVV        60
     LIAFALTLLT VPYLKIVGAL LLWVGVKLLI PEDDAHGNIK GGTSIAAAVK TIIIADFVMS       120
     LDNVIAIAGA AQGAAQEHQL GLVIFGLVVS VPIIIWGSTL VLKLIDRFPM VVTFGAALLG       180
     WIAGGMLVTD VVVVERFGEV SGVAKIAAEV AGALLIVGLG RWFARRKAAA APQTARESA        239
//

If you have problems or comments...

PBIL Back to PBIL home page