(data stored in ACNUC1104 zone)

EMBL: BX640427.PE295

BX640427.PE295       Location/Qualifiers
FT   CDS             complement(299793..301004)
FT                   /transl_table=11
FT                   /locus_tag="BPP1587"
FT                   /product="probable two-component response regulator"
FT                   /note="Similar to Pseudomonas aeruginosa probable
FT                   two-component response regulator Pa3947 SWALL:Q9HX69
FT                   (EMBL:AE004813) (392 aa) fasta scores: E(): 1.8e-57, 44.83%
FT                   id in 397 aa, and to Ralstonia solanacearum probable
FT                   two-component response regulator transcription regulator
FT                   protein Rsc3387 or rs06101 SWALL:Q8XU07 (EMBL:AL646075)
FT                   (403 aa) fasta scores: E(): 2e-26, 32.39% id in 392 aa"
FT                   /db_xref="GOA:Q7WA10"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WA10"
FT                   /protein_id="CAE36888.1"
FT                   /translation="MNLPDILVVEDHPAHRLVVVHALRALGYTRILEAADGNEALRRLN
FT                   EHGQVGIAICDIKMSGMDGAQFLRVAARRQLLGAVIISSDVSSDLIAAVLDMAALIGLR
FT                   VLGDLAKPLDAQRLKALLDRHEAERQRARANAAPTASRQPPAPPAREVARALAAGQIVP
FT                   YFQPKVDLLTLRPCGAEVLARWRHPDLGVLGPASFLEALKEQDLLDRLIWHLTDAALGQ
FT                   ARLLATAGATQDLALNFETSQLGSAELLPTLAQALRKHALPASIVTIEVTENGLLDAPA
FT                   ATLENLVRLRLMGCTVSIDDFGTGFSSMQRLCHLPFNQLKIDASFVRRLPGDARSESVV
FT                   AATLAMAERLGITVVAEDIENPPQHQALLQLHCRQGQGYLFARPMSGPDYARWLDGAAS
FT                   AAAG"
     MNLPDILVVE DHPAHRLVVV HALRALGYTR ILEAADGNEA LRRLNEHGQV GIAICDIKMS        60
     GMDGAQFLRV AARRQLLGAV IISSDVSSDL IAAVLDMAAL IGLRVLGDLA KPLDAQRLKA       120
     LLDRHEAERQ RARANAAPTA SRQPPAPPAR EVARALAAGQ IVPYFQPKVD LLTLRPCGAE       180
     VLARWRHPDL GVLGPASFLE ALKEQDLLDR LIWHLTDAAL GQARLLATAG ATQDLALNFE       240
     TSQLGSAELL PTLAQALRKH ALPASIVTIE VTENGLLDAP AATLENLVRL RLMGCTVSID       300
     DFGTGFSSMQ RLCHLPFNQL KIDASFVRRL PGDARSESVV AATLAMAERL GITVVAEDIE       360
     NPPQHQALLQ LHCRQGQGYL FARPMSGPDY ARWLDGAASA AAG                         403
//

If you have problems or comments...

PBIL Back to PBIL home page