(data stored in ACNUC1104 zone)

EMBL: BX640427.PE296

BX640427.PE296       Location/Qualifiers
FT   CDS             301318..301827
FT                   /transl_table=11
FT                   /locus_tag="BPP1588"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Rhizobium leguminosarum hypothetical 14.7
FT                   kDa protein SWALL:Q9AE37 (EMBL:AJ310723) (135 aa) fasta
FT                   scores: E(): 0.0057, 28.82% id in 111 aa, and to Rhizobium
FT                   meliloti hypothetical protein R02424 or Smc01516
FT                   SWALL:Q92N19 (EMBL:AL591790) (137 aa) fasta scores: E():
FT                   0.0024, 33.67% id in 98 aa"
FT                   /db_xref="InterPro:IPR016772"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WA09"
FT                   /protein_id="CAE36889.1"
FT                   /translation="MVLRGALVAQTSALAWAREDRAALEASLPGLPRRRVLARRLDFLM
FT                   ERVQSLLRARSGGTPGPALMVDASAKSVLCVGAGGAAARAARAAIERAGGRFLHHDGEV
FT                   GDAAGLEASLVSADLVICQTGCVSHGAYWRVQDHCKRTGKQCVLVEQPAALNIVRVRRP
FT                   ADAPQD"
     MVLRGALVAQ TSALAWARED RAALEASLPG LPRRRVLARR LDFLMERVQS LLRARSGGTP        60
     GPALMVDASA KSVLCVGAGG AAARAARAAI ERAGGRFLHH DGEVGDAAGL EASLVSADLV       120
     ICQTGCVSHG AYWRVQDHCK RTGKQCVLVE QPAALNIVRV RRPADAPQD                   169
//

If you have problems or comments...

PBIL Back to PBIL home page