(data stored in ACNUC1104 zone)

EMBL: BX640427.PE297

BX640427.PE297       Location/Qualifiers
FT   CDS             301954..302745
FT                   /transl_table=11
FT                   /locus_tag="BPP1589"
FT                   /product="putative transmembrane regulator"
FT                   /note="Similar to Pseudomonas fluorescens transmembrane
FT                   regulator PrtR SWALL:Q9KIN0 (EMBL:AF228766) (242 aa) fasta
FT                   scores: E(): 0.0013, 31.12% id in 241 aa, and to Rhizobium
FT                   loti hypothetical protein Mlr0408 SWALL:Q98MW6
FT                   (EMBL:AP002994) (257 aa) fasta scores: E(): 2.1e-21, 39.04%
FT                   id in 251 aa"
FT                   /db_xref="GOA:Q7WA08"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WA08"
FT                   /protein_id="CAE36890.1"
FT                   /translation="MKGGPADPIADVELDAYIDGQLDSARRADVEAFLARDARAAARVS
FT                   ADLRLRDALRQGATRHGAGARDAHTRALADRLQAAHARRRVARRARRLLAVAILVAAGW
FT                   AGHAALTAWTPAEPAGDAGVQVFLDEAMRAHRTAQLRAGMRSQPAAPRLDRAELARQAG
FT                   VPLPAWPWDWLPRDVQVFPSRGGPAVEVALLAGRAGPISLYGAPGGAGPDSAPRMARGA
FT                   GAEALFWWRRGAWVYAVIGALPEAALRPLAQRLADAPLVHE"
     MKGGPADPIA DVELDAYIDG QLDSARRADV EAFLARDARA AARVSADLRL RDALRQGATR        60
     HGAGARDAHT RALADRLQAA HARRRVARRA RRLLAVAILV AAGWAGHAAL TAWTPAEPAG       120
     DAGVQVFLDE AMRAHRTAQL RAGMRSQPAA PRLDRAELAR QAGVPLPAWP WDWLPRDVQV       180
     FPSRGGPAVE VALLAGRAGP ISLYGAPGGA GPDSAPRMAR GAGAEALFWW RRGAWVYAVI       240
     GALPEAALRP LAQRLADAPL VHE                                               263
//

If you have problems or comments...

PBIL Back to PBIL home page