(data stored in ACNUC1104 zone)

EMBL: BX640427.PE298

BX640427.PE298       Location/Qualifiers
FT   CDS             302939..303376
FT                   /transl_table=11
FT                   /locus_tag="BPP1590"
FT                   /product="putative universal stress protein"
FT                   /note="Similar to Brucella melitensis universal stress
FT                   protein family Bmeii0245 SWALL:Q8YDD2 (EMBL:AE009663) (148
FT                   aa) fasta scores: E(): 3.2e-18, 46.3% id in 149 aa, and to
FT                   Agrobacterium tumefaciens hypothetical protein Atu0496 or
FT                   Agr_c_878 SWALL:Q8UI04 (EMBL:AE009019) (160 aa) fasta
FT                   scores: E(): 9.1e-19, 48.96% id in 145 aa"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WA07"
FT                   /protein_id="CAE36891.1"
FT                   /translation="MYQHILIPIDGSDLANTAIDKGLALAKALGARVTVLTVVEPYPHM
FT                   AAEAVQLGGLRKEYEKQVHARASEWLEPAGAKAAAAGVPCELLKRDADMAFRAIVETAA
FT                   ERGCDLIAMASHGRGGVAAVLLGSQTQKVLAHSQVPVLVYR"
     MYQHILIPID GSDLANTAID KGLALAKALG ARVTVLTVVE PYPHMAAEAV QLGGLRKEYE        60
     KQVHARASEW LEPAGAKAAA AGVPCELLKR DADMAFRAIV ETAAERGCDL IAMASHGRGG       120
     VAAVLLGSQT QKVLAHSQVP VLVYR                                             145
//

If you have problems or comments...

PBIL Back to PBIL home page