(data stored in ACNUC1104 zone)

EMBL: BX640427.PE300

BX640427.PE300       Location/Qualifiers
FT   CDS             304550..304918
FT                   /transl_table=11
FT                   /locus_tag="BPP1592"
FT                   /product="putative exported protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1175"
FT                   /db_xref="InterPro:IPR005220"
FT                   /db_xref="InterPro:IPR036700"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WA05"
FT                   /protein_id="CAE36893.1"
FT                   /translation="MSKSIVLTLAAVALATQAGLAQAQYVGPSSNQQMSVKELLDTARD
FT                   DAVVTLRGKLVKQLSDDTYLLDDGTGRVQVEIDRHLFPPNQPVDANTLVEVSGEFDKEV
FT                   IGTSEVEVKALRILGAAK"
     MSKSIVLTLA AVALATQAGL AQAQYVGPSS NQQMSVKELL DTARDDAVVT LRGKLVKQLS        60
     DDTYLLDDGT GRVQVEIDRH LFPPNQPVDA NTLVEVSGEF DKEVIGTSEV EVKALRILGA       120
     AK                                                                      122
//

If you have problems or comments...

PBIL Back to PBIL home page