(data stored in ACNUC1104 zone)

EMBL: BX640427.PE301

BX640427.PE301       Location/Qualifiers
FT   CDS             complement(304884..305603)
FT                   /transl_table=11
FT                   /locus_tag="BPP1593"
FT                   /product="hypothetical protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1174"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WA04"
FT                   /protein_id="CAE36894.1"
FT                   /translation="MGRRARRPGSGRRFFGHGGYDPRHGDLIRLPLHFYKFPAAELPGA
FT                   RPGPTLYRLASEHAMEIAALTWSTPLARLAPVPPRTSAAPPSHDWPHAAPSVRPHGAAG
FT                   PAAAPADLLRDLHAQARMARAVAAYQAEQAARQTAARSPCAAQGLGDIDCLMVLQAYRV
FT                   AMPMRRCRTCRECRPRRNAAARPWARSRGPALPISKYVDKSGSYRQKLRNNLKKRDAAC
FT                   KQPTVAAIWPRRGCAAP"
     MGRRARRPGS GRRFFGHGGY DPRHGDLIRL PLHFYKFPAA ELPGARPGPT LYRLASEHAM        60
     EIAALTWSTP LARLAPVPPR TSAAPPSHDW PHAAPSVRPH GAAGPAAAPA DLLRDLHAQA       120
     RMARAVAAYQ AEQAARQTAA RSPCAAQGLG DIDCLMVLQA YRVAMPMRRC RTCRECRPRR       180
     NAAARPWARS RGPALPISKY VDKSGSYRQK LRNNLKKRDA ACKQPTVAAI WPRRGCAAP        239
//

If you have problems or comments...

PBIL Back to PBIL home page