(data stored in ACNUC1104 zone)

EMBL: BX640427.PE303

BX640427.PE303       Location/Qualifiers
FT   CDS             complement(307279..307857)
FT                   /transl_table=11
FT                   /locus_tag="BPP1595"
FT                   /product="conserved hypothetical protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1171"
FT                   /db_xref="InterPro:IPR009569"
FT                   /db_xref="InterPro:IPR035936"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WA02"
FT                   /protein_id="CAE36896.1"
FT                   /translation="MSLIEIRKRTLIVETTYHENGPAPAQPLKLAASCAVIRNPYAGRY
FT                   EPDLMPFMAELRSLGTLLATELVDTLGKDNIEVYSKAAIVGVDGEMEHGAVWHEAGGWA
FT                   MRSVLGEPKAMVPAVKAVATAGYRMMVPVHYIHASYVRSHFNSIEIGIQDAPRPREILF
FT                   ALVMGTGARVHARLGGLTKEAVSVHDGQR"
     MSLIEIRKRT LIVETTYHEN GPAPAQPLKL AASCAVIRNP YAGRYEPDLM PFMAELRSLG        60
     TLLATELVDT LGKDNIEVYS KAAIVGVDGE MEHGAVWHEA GGWAMRSVLG EPKAMVPAVK       120
     AVATAGYRMM VPVHYIHASY VRSHFNSIEI GIQDAPRPRE ILFALVMGTG ARVHARLGGL       180
     TKEAVSVHDG QR                                                           192
//

If you have problems or comments...

PBIL Back to PBIL home page