(data stored in ACNUC1104 zone)

EMBL: BX640427.PE304

BX640427.PE304       Location/Qualifiers
FT   CDS             complement(307882..308835)
FT                   /transl_table=11
FT                   /locus_tag="BPP1596"
FT                   /product="putative exported protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1170"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WA01"
FT                   /protein_id="CAE36897.1"
FT                   /translation="MFKPLFATAALALAIGQATAAYPERPIRMVVPFPPGSITDVVARS
FT                   LGQGMAAELGQPVVVENKPGANGIIGTQDVVKAQPDGYTLVVVGVSTAASGVSLFKNLP
FT                   YDPARDLTPIGAVAETPYLLVGGQDVAGKTVADLYDYGRQHPDKLTYAYGSGSAQVFGA
FT                   KLAAMGDITVTPVPYRGGPQALTDVIGGTVDLTFTDLANGLQQARAGKVKVYGVSTPGR
FT                   FALTPDIPTLNESGAPGFDLTVWFGLMGPAGLPPAVTERLAGALDKALAAPELTQTYAR
FT                   QGLSVKTQGPAAFGAFVRSEIEKWAGIVKETGIAPQ"
     MFKPLFATAA LALAIGQATA AYPERPIRMV VPFPPGSITD VVARSLGQGM AAELGQPVVV        60
     ENKPGANGII GTQDVVKAQP DGYTLVVVGV STAASGVSLF KNLPYDPARD LTPIGAVAET       120
     PYLLVGGQDV AGKTVADLYD YGRQHPDKLT YAYGSGSAQV FGAKLAAMGD ITVTPVPYRG       180
     GPQALTDVIG GTVDLTFTDL ANGLQQARAG KVKVYGVSTP GRFALTPDIP TLNESGAPGF       240
     DLTVWFGLMG PAGLPPAVTE RLAGALDKAL AAPELTQTYA RQGLSVKTQG PAAFGAFVRS       300
     EIEKWAGIVK ETGIAPQ                                                      317
//

If you have problems or comments...

PBIL Back to PBIL home page