(data stored in ACNUC1104 zone)

EMBL: BX640427.PE311

BX640427.PE311       Location/Qualifiers
FT   CDS             complement(315221..316666)
FT                   /transl_table=11
FT                   /locus_tag="BPP1603"
FT                   /product="putative membrane protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1164"
FT                   /db_xref="GOA:Q7W9Z5"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W9Z5"
FT                   /protein_id="CAE36904.1"
FT                   /translation="MPPSRHLPPITALLSFRLNQLAQAGAGLPHPTRAIAVAAILINVF
FT                   MATLESAIANTALPAIAADLGVSEASSIWVISAYHLAMVAALLPIASLGEIIGHRRISM
FT                   AGLVLFTLASLACGLAPSLPWLIAGRLAQGVGAAGILGVALAMTRFVYPREQLGCGLGL
FT                   NALVVSLSLAAGPTAASLILSLGSWHWLFLINVPLGLALGVCALPPTPRSARRYDAVAG
FT                   LLCALFLALLVYTLNAYAHDVGAGGNTAYALATLAMLALLLRRQSGRGAPMLATDLLRR
FT                   PIFALSAAATLGAFAAQTLAFVALPFMLQSLLGYTQVQTGFLITPWPALAALSAASAGA
FT                   LSDRHPPGLLGGIGMAVLAAGLLSLVALPAAPDAFDLGWRMALCGAGFGFFQAPNMRAM
FT                   LADAPPERSGGASGMTSSSIMLGQSLGAALVAGLFTLRGAAAAPAALWLGVAFAVIAGI
FT                   ASLLRLRHAAAAGAGARLDLTRV"
     MPPSRHLPPI TALLSFRLNQ LAQAGAGLPH PTRAIAVAAI LINVFMATLE SAIANTALPA        60
     IAADLGVSEA SSIWVISAYH LAMVAALLPI ASLGEIIGHR RISMAGLVLF TLASLACGLA       120
     PSLPWLIAGR LAQGVGAAGI LGVALAMTRF VYPREQLGCG LGLNALVVSL SLAAGPTAAS       180
     LILSLGSWHW LFLINVPLGL ALGVCALPPT PRSARRYDAV AGLLCALFLA LLVYTLNAYA       240
     HDVGAGGNTA YALATLAMLA LLLRRQSGRG APMLATDLLR RPIFALSAAA TLGAFAAQTL       300
     AFVALPFMLQ SLLGYTQVQT GFLITPWPAL AALSAASAGA LSDRHPPGLL GGIGMAVLAA       360
     GLLSLVALPA APDAFDLGWR MALCGAGFGF FQAPNMRAML ADAPPERSGG ASGMTSSSIM       420
     LGQSLGAALV AGLFTLRGAA AAPAALWLGV AFAVIAGIAS LLRLRHAAAA GAGARLDLTR       480
     V                                                                       481
//

If you have problems or comments...

PBIL Back to PBIL home page