(data stored in ACNUC1104 zone)

EMBL: BX640427.PE321

BX640427.PE321       Location/Qualifiers
FT   CDS             325703..327361
FT                   /transl_table=11
FT                   /locus_tag="BPP1613"
FT                   /product="probable methyl-accepting chemotaxis protein"
FT                   /note="Similar to Ralstonia solanacearum probable
FT                   methyl-accepting chemotaxis transducer transmembrane
FT                   protein Rsp0255 or Rs03711 SWALL:Q8XT60 (EMBL:AL646077)
FT                   (529 aa) fasta scores: E(): 1.7e-67, 44.15% id in 530 aa,
FT                   and to Yersinia pestis putative methyl-accepting chemotaxis
FT                   protein Ypo1644 SWALL:Q8ZFP9 (EMBL:AJ414149) (526 aa) fasta
FT                   scores: E(): 1.4e-56, 40.78% id in 532 aa"
FT                   /db_xref="GOA:Q7W9Y6"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W9Y6"
FT                   /protein_id="CAE36914.1"
FT                   /translation="MRRNLPVTGHEFVLQDDQYLISKTDLKGRITYCNPAFIAISGFSR
FT                   EELLGQPHNIVRHPDMPEDVFADMWATLQARKPWLAVVKNRHKSGGFYWVLANAMPVIE
FT                   AGNVTGYASVRVKATQAQIEAAEHFYAQVESGRMGGHGLRHGQRVPRGWRRAARALAFP
FT                   LRKGVRPALLRLAAAMCGLAAIPTYFAIGAMPPEAAPYGWGAYALGALGAVLAAMALGG
FT                   RFGRQLRNAEEVARQIAAGNLVNEVDSGVGGEMRNLYFYLDIMRKSLIGISTEVIGKTS
FT                   EHVHTISRLREDSQGLAARTEAQSAALQDTASSVEQLAETVTRNAESAGVAARLTQESS
FT                   EVAAQGGAVVGELVATMQGLDASSRKMAEIVSVIEGIAFQTNILALNAAVEAARAGEQG
FT                   KGFAVVAAEVRSLAQRTAQAAKEVKVLIDDSVGRMSTGSAQAGRAGETMRELVQSVERV
FT                   TALMAEISTASGEQSTGVAQISSAVHRMEEVVQQNVSMVGELTHVAEHLGQESGSLVEA
FT                   IGVFRTPGAGARAIGMPEQAPRRAPARTLLLAEHP"
     MRRNLPVTGH EFVLQDDQYL ISKTDLKGRI TYCNPAFIAI SGFSREELLG QPHNIVRHPD        60
     MPEDVFADMW ATLQARKPWL AVVKNRHKSG GFYWVLANAM PVIEAGNVTG YASVRVKATQ       120
     AQIEAAEHFY AQVESGRMGG HGLRHGQRVP RGWRRAARAL AFPLRKGVRP ALLRLAAAMC       180
     GLAAIPTYFA IGAMPPEAAP YGWGAYALGA LGAVLAAMAL GGRFGRQLRN AEEVARQIAA       240
     GNLVNEVDSG VGGEMRNLYF YLDIMRKSLI GISTEVIGKT SEHVHTISRL REDSQGLAAR       300
     TEAQSAALQD TASSVEQLAE TVTRNAESAG VAARLTQESS EVAAQGGAVV GELVATMQGL       360
     DASSRKMAEI VSVIEGIAFQ TNILALNAAV EAARAGEQGK GFAVVAAEVR SLAQRTAQAA       420
     KEVKVLIDDS VGRMSTGSAQ AGRAGETMRE LVQSVERVTA LMAEISTASG EQSTGVAQIS       480
     SAVHRMEEVV QQNVSMVGEL THVAEHLGQE SGSLVEAIGV FRTPGAGARA IGMPEQAPRR       540
     APARTLLLAE HP                                                           552
//

If you have problems or comments...

PBIL Back to PBIL home page