(data stored in ACNUC1104 zone)

EMBL: BX640427.PE323

BX640427.PE323       Location/Qualifiers
FT   CDS             329205..330176
FT                   /transl_table=11
FT                   /locus_tag="BPP1615"
FT                   /product="putative membrane protein"
FT                   /note="Similar to Streptomyces coelicolor putative membrane
FT                   transport protein Sc8f11.16C SWALL:Q9KZG2 (EMBL:AL353864)
FT                   (325 aa) fasta scores: E(): 6.2e-07, 30.03% id in 293 aa,
FT                   and to Pseudomonas aeruginosa probable Mfs transporter
FT                   Pa2701 SWALL:Q9I0E1 (EMBL:AE004698) (529 aa) fasta scores:
FT                   E(): 0.0055, 34.35% id in 195 aa"
FT                   /db_xref="GOA:Q7W9Y4"
FT                   /db_xref="InterPro:IPR002657"
FT                   /db_xref="InterPro:IPR004706"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W9Y4"
FT                   /protein_id="CAE36916.1"
FT                   /translation="MQRLQASLERRQVGIYFAAMALGAVLAWHRPGLQVGEATLNLMLA
FT                   GMLLATFMQVPLAGWRATLPGMRFLGVLLSVNFVLVPALVWGLAALLPADPMIRLAVLL
FT                   VLLAPCIDYVVTFAQLGRADARALLAATPVLLCGQMLLLPLYLNVMLGSDAAALIRPGP
FT                   FVQAFVWLIALPLAAATGVQWAAARSAAWRGAASVVGLLPVPATALVLATIVAAVAPRM
FT                   ALAGEAVSRVVPVYLLFAVIAPAAGWLAARRARLAAPQARAVAFSAGTRNSLVVLPLAL
FT                   AVPGGVPLLPALIVAQTLVELCAELLYVRVFGRAGKDRAGEG"
     MQRLQASLER RQVGIYFAAM ALGAVLAWHR PGLQVGEATL NLMLAGMLLA TFMQVPLAGW        60
     RATLPGMRFL GVLLSVNFVL VPALVWGLAA LLPADPMIRL AVLLVLLAPC IDYVVTFAQL       120
     GRADARALLA ATPVLLCGQM LLLPLYLNVM LGSDAAALIR PGPFVQAFVW LIALPLAAAT       180
     GVQWAAARSA AWRGAASVVG LLPVPATALV LATIVAAVAP RMALAGEAVS RVVPVYLLFA       240
     VIAPAAGWLA ARRARLAAPQ ARAVAFSAGT RNSLVVLPLA LAVPGGVPLL PALIVAQTLV       300
     ELCAELLYVR VFGRAGKDRA GEG                                               323
//

If you have problems or comments...

PBIL Back to PBIL home page