(data stored in ACNUC1104 zone)

EMBL: BX640427.PE324

BX640427.PE324       Location/Qualifiers
FT   CDS             complement(330189..330494)
FT                   /transl_table=11
FT                   /locus_tag="BPP1616"
FT                   /product="hypothetical protein"
FT                   /note="no significant database matches"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W9Y3"
FT                   /protein_id="CAE36917.1"
FT                   /translation="MPAKDVPYQSMNLLCAILPEGNTSNRVGRRLADLLVQDAQGRLYR
FT                   VERHRIEGGHPDLVCGIDYIYCRLAGGGVVRCIDEQTYELPDGTVAHVVPDSTLRS"
     MPAKDVPYQS MNLLCAILPE GNTSNRVGRR LADLLVQDAQ GRLYRVERHR IEGGHPDLVC        60
     GIDYIYCRLA GGGVVRCIDE QTYELPDGTV AHVVPDSTLR S                           101
//

If you have problems or comments...

PBIL Back to PBIL home page