(data stored in ACNUC1104 zone)

EMBL: BX640427.PE33

BX640427.PE33        Location/Qualifiers
FT   CDS             complement(34907..35557)
FT                   /transl_table=11
FT                   /locus_tag="BPP1324"
FT                   /product="conserved hypothetical protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2156"
FT                   /db_xref="InterPro:IPR003680"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAP8"
FT                   /protein_id="CAE36626.1"
FT                   /translation="MDSSQVPNPVLVLVGSPRRDGNSALLAQAVAEGARQSGAVATLLF
FT                   LDDYIAGFLTDEKEADARRPDDRYGELFFDHFLPARAVVLCTPVYWYGMSAQAKAFFDR
FT                   SFTYYSASHPRHAEVLRRMTGKRLALAVSSEETYPGAALGIVHQLQEFTRYTHSQFVGM
FT                   VHGAGNRRGEVAHDPRRPLQAAHRLGHGLLSLPYSDYRIDSPRDHQVWPGAPA"
     MDSSQVPNPV LVLVGSPRRD GNSALLAQAV AEGARQSGAV ATLLFLDDYI AGFLTDEKEA        60
     DARRPDDRYG ELFFDHFLPA RAVVLCTPVY WYGMSAQAKA FFDRSFTYYS ASHPRHAEVL       120
     RRMTGKRLAL AVSSEETYPG AALGIVHQLQ EFTRYTHSQF VGMVHGAGNR RGEVAHDPRR       180
     PLQAAHRLGH GLLSLPYSDY RIDSPRDHQV WPGAPA                                 216
//

If you have problems or comments...

PBIL Back to PBIL home page