(data stored in ACNUC1104 zone)

EMBL: BX640427.PE331

BX640427.PE331       Location/Qualifiers
FT   CDS             337482..337733
FT                   /transl_table=11
FT                   /locus_tag="BPP1623"
FT                   /product="hypothetical protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP0896"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W9X6"
FT                   /protein_id="CAE36924.1"
FT                   /translation="MVQKVLNGFAVVAFATQPEHGMPPRAFIQTAPMDGAGQAEPQVFE
FT                   IFLARRFRSAVEAMSAARNALDRVVSVDQDGVPAPLPD"
     MVQKVLNGFA VVAFATQPEH GMPPRAFIQT APMDGAGQAE PQVFEIFLAR RFRSAVEAMS        60
     AARNALDRVV SVDQDGVPAP LPD                                                83
//

If you have problems or comments...

PBIL Back to PBIL home page