(data stored in ACNUC1104 zone)

EMBL: BX640427.PE333

BX640427.PE333       Location/Qualifiers
FT   CDS             complement(338181..339998)
FT                   /transl_table=11
FT                   /locus_tag="BPP1625"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP0899"
FT                   /db_xref="GOA:Q7W9X4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W9X4"
FT                   /protein_id="CAE36926.1"
FT                   /translation="MMPSPSPTPAGRNSLDTLRTLAPFLWPADRPGLKARVVIAILCLL
FT                   AAKAAVVYVPILYKSAVDQLGGGAPGAVTVPLGLILAYSAARVLSLLFSELRDAVFARV
FT                   GQHAIRAVGLQIFRHLHALALRFHLARQTGGLTRAIERGTKGIQTLLTFLLFNVLPTLF
FT                   EIGLVCAVLWKMFDGWLALATGATVTLYLAYTLVVTEWRTRFRRQMNETDSEANTKAVE
FT                   SLLNYETVKYFGNEEHEAQRYDASLRRYERAAVRSQVSLSILNIGQAVIISAGLTLVMW
FT                   MAARGIAQGRYTLGDFVLVNTYLLQLYDPLSFFGFIYREIKQALIDMERMFELLGEGRE
FT                   IADPPGALALRLEGGAVEFRDVYFGYDPRRPILKGVSFRIPAGKTVAVVGTSGAGKSTL
FT                   ARLLFRFYDADRGAILVDGQDVRGVTQASLRAAIGVVPEDTVLFNDTIHYNIAYGRPGA
FT                   SDGEVQAAARLAHIHDLIMAMPDGYRTMVGERGLKLSGGEKQRVAIARTLLKNPSIFLF
FT                   DEATSALDTHTEREIQANLREVSQGRSTLIIAHRLSTIADADEIIVLGDGRVVERGRHQ
FT                   ALLAQGGIYAGMWARQQEATRPAAVALDD"
     MMPSPSPTPA GRNSLDTLRT LAPFLWPADR PGLKARVVIA ILCLLAAKAA VVYVPILYKS        60
     AVDQLGGGAP GAVTVPLGLI LAYSAARVLS LLFSELRDAV FARVGQHAIR AVGLQIFRHL       120
     HALALRFHLA RQTGGLTRAI ERGTKGIQTL LTFLLFNVLP TLFEIGLVCA VLWKMFDGWL       180
     ALATGATVTL YLAYTLVVTE WRTRFRRQMN ETDSEANTKA VESLLNYETV KYFGNEEHEA       240
     QRYDASLRRY ERAAVRSQVS LSILNIGQAV IISAGLTLVM WMAARGIAQG RYTLGDFVLV       300
     NTYLLQLYDP LSFFGFIYRE IKQALIDMER MFELLGEGRE IADPPGALAL RLEGGAVEFR       360
     DVYFGYDPRR PILKGVSFRI PAGKTVAVVG TSGAGKSTLA RLLFRFYDAD RGAILVDGQD       420
     VRGVTQASLR AAIGVVPEDT VLFNDTIHYN IAYGRPGASD GEVQAAARLA HIHDLIMAMP       480
     DGYRTMVGER GLKLSGGEKQ RVAIARTLLK NPSIFLFDEA TSALDTHTER EIQANLREVS       540
     QGRSTLIIAH RLSTIADADE IIVLGDGRVV ERGRHQALLA QGGIYAGMWA RQQEATRPAA       600
     VALDD                                                                   605
//

If you have problems or comments...

PBIL Back to PBIL home page