(data stored in ACNUC1104 zone)

EMBL: BX640427.PE41

BX640427.PE41        Location/Qualifiers
FT   CDS             41666..42190
FT                   /transl_table=11
FT                   /locus_tag="BPP1332"
FT                   /product="putative exported protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2147"
FT                   /db_xref="InterPro:IPR005180"
FT                   /db_xref="InterPro:IPR016796"
FT                   /db_xref="InterPro:IPR035923"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAP2"
FT                   /protein_id="CAE36634.1"
FT                   /translation="MQCPAFPGRFLRSSRMQISRHFPRLARRAALALCLAGAAQVHAQE
FT                   AAVQRKSDYPFAATVARLQDALRAKGMTIFAVIDHQAAAKQAGLDMPPTQVVVYGNPKA
FT                   GTPLMLAAPDFALELPLKVLVRETASGEVLVVYHPAGTREGMLGLPAGMAQQLAGAERI
FT                   VDAAVRRAPAD"
     MQCPAFPGRF LRSSRMQISR HFPRLARRAA LALCLAGAAQ VHAQEAAVQR KSDYPFAATV        60
     ARLQDALRAK GMTIFAVIDH QAAAKQAGLD MPPTQVVVYG NPKAGTPLML AAPDFALELP       120
     LKVLVRETAS GEVLVVYHPA GTREGMLGLP AGMAQQLAGA ERIVDAAVRR APAD             174
//

If you have problems or comments...

PBIL Back to PBIL home page