(data stored in ACNUC1104 zone)

EMBL: BX640427.PE44

BX640427.PE44        Location/Qualifiers
FT   CDS             43518..44069
FT                   /transl_table=11
FT                   /locus_tag="BPP1335"
FT                   /product="conserved hypothetical protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2144"
FT                   /db_xref="InterPro:IPR013538"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="PDB:2K5G"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAN9"
FT                   /protein_id="CAE36637.1"
FT                   /translation="MTSPSSAFPDGHGARLDAQSIRFERLLPGPIERVWAWLADADKRA
FT                   RWLAGGELPRQPGQTFELHFNHAALTAETAPARYAQYDRPIVARHTLLRCEPPRVLALT
FT                   WGGGAGEAPSEVLFELSEAGEQVRLVLTHTRLADRAAMLDVAGGWHAHLAVLAGKLAGQ
FT                   APPPFWTTLAQAEQDYEQRL"
     MTSPSSAFPD GHGARLDAQS IRFERLLPGP IERVWAWLAD ADKRARWLAG GELPRQPGQT        60
     FELHFNHAAL TAETAPARYA QYDRPIVARH TLLRCEPPRV LALTWGGGAG EAPSEVLFEL       120
     SEAGEQVRLV LTHTRLADRA AMLDVAGGWH AHLAVLAGKL AGQAPPPFWT TLAQAEQDYE       180
     QRL                                                                     183
//

If you have problems or comments...

PBIL Back to PBIL home page