(data stored in ACNUC1104 zone)

EMBL: BX640427.PE47

BX640427.PE47        Location/Qualifiers
FT   CDS             complement(46754..47212)
FT                   /transl_table=11
FT                   /locus_tag="BPP1338"
FT                   /product="putative exported protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2141"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAN6"
FT                   /protein_id="CAE36640.1"
FT                   /translation="MHTRARHATSPLPAMPTSLPARAYALPLILPLLLAACSDAVQTQY
FT                   RDLDEARAAGAIQRGWLPAWLPARTGAIAEAHDLDTNRRAARFVLPDGARIEPPGCAPA
FT                   SGRLPPPALALPGWPASLHQDGAAGRYRLYRCADGYAAFDASHGYLWN"
     MHTRARHATS PLPAMPTSLP ARAYALPLIL PLLLAACSDA VQTQYRDLDE ARAAGAIQRG        60
     WLPAWLPART GAIAEAHDLD TNRRAARFVL PDGARIEPPG CAPASGRLPP PALALPGWPA       120
     SLHQDGAAGR YRLYRCADGY AAFDASHGYL WN                                     152
//

If you have problems or comments...

PBIL Back to PBIL home page