(data stored in ACNUC1104 zone)

EMBL: BX640427.PE5

BX640427.PE5         Location/Qualifiers
FT   CDS             3367..4881
FT                   /transl_table=11
FT                   /locus_tag="BPP1296"
FT                   /product="ABC transport protein, solute binding component"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2594"
FT                   /db_xref="GOA:Q7WAS2"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAS2"
FT                   /protein_id="CAE36598.1"
FT                   /translation="MMSKTGKMAAALAALCLSVGLAGAARAESTLQVALFTSLNSLDPN
FT                   VTTLGEEYVFNGLVFGGLTRIDANSKVVPDLAVSWTPSADLREWTFKLRPGVKFHHGKP
FT                   LTASDVVFSFQRIVDPATGSPGRTQLEVMKSVDAPDDATVHFTLTQPYADFPGLLTGRQ
FT                   LRVVAQDRIDTIKTQPSGTGPFRFVRYTPGDQLELERNPDYYDKDRIKIDRVVMRVMPE
FT                   AAARVAALRSGSIDMIWNLPLETIPDLKKDAAVVVDSVPSASWDGIVLNNSKPPFNDVR
FT                   VRRAVFLALDKKELVNFALFGEGSPTHSPIAPTDPAFNKDIGFAPDLAQAKQLLAEAGY
FT                   AKGFAVDIFVPAGRPSRERLGVAAQQLLRPLGIKLNVQRVPYNRYSAGVAGIAPMYVDG
FT                   FFASPVIDAATSPWFYSTGSWNARMWHFSSKRVDQALDAARASTDRAEQIRHYQDFQRA
FT                   LTEEVPGVIGYVTNVATAYRADIKNYHTNPFLWLDLYDVEKTGGAR"
     MMSKTGKMAA ALAALCLSVG LAGAARAEST LQVALFTSLN SLDPNVTTLG EEYVFNGLVF        60
     GGLTRIDANS KVVPDLAVSW TPSADLREWT FKLRPGVKFH HGKPLTASDV VFSFQRIVDP       120
     ATGSPGRTQL EVMKSVDAPD DATVHFTLTQ PYADFPGLLT GRQLRVVAQD RIDTIKTQPS       180
     GTGPFRFVRY TPGDQLELER NPDYYDKDRI KIDRVVMRVM PEAAARVAAL RSGSIDMIWN       240
     LPLETIPDLK KDAAVVVDSV PSASWDGIVL NNSKPPFNDV RVRRAVFLAL DKKELVNFAL       300
     FGEGSPTHSP IAPTDPAFNK DIGFAPDLAQ AKQLLAEAGY AKGFAVDIFV PAGRPSRERL       360
     GVAAQQLLRP LGIKLNVQRV PYNRYSAGVA GIAPMYVDGF FASPVIDAAT SPWFYSTGSW       420
     NARMWHFSSK RVDQALDAAR ASTDRAEQIR HYQDFQRALT EEVPGVIGYV TNVATAYRAD       480
     IKNYHTNPFL WLDLYDVEKT GGAR                                              504
//

If you have problems or comments...

PBIL Back to PBIL home page