(data stored in ACNUC1104 zone)

EMBL: BX640427.PE52

BX640427.PE52        Location/Qualifiers
FT   CDS             51546..51740
FT                   /transl_table=11
FT                   /locus_tag="BPP1343"
FT                   /product="putative membrane protein"
FT                   /note="Similar to Hordeum vulgare low-temperature induced
FT                   protein Lt101.2 SWALL:LT02_HORVU (SWALL:Q9ARD5) (54 aa)
FT                   fasta scores: E(): 0.042, 45.83% id in 48 aa, and to
FT                   Xylella fastidiosa hypothetical protein Xf0135 SWALL:Q9PH11
FT                   (EMBL:AE003867) (64 aa) fasta scores: E(): 4.6e-15, 65.51%
FT                   id in 58 aa"
FT                   /db_xref="GOA:Q7WAN1"
FT                   /db_xref="InterPro:IPR000612"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAN1"
FT                   /protein_id="CAE36645.1"
FT                   /translation="MRLLLAIFLPFTVFFTIGRPIAGIICLLLQITLIGWIPAALWAVY
FT                   ALSQFHTDRKIRDAVGGRG"
     MRLLLAIFLP FTVFFTIGRP IAGIICLLLQ ITLIGWIPAA LWAVYALSQF HTDRKIRDAV        60
     GGRG                                                                     64
//

If you have problems or comments...

PBIL Back to PBIL home page