(data stored in ACNUC1104 zone)

EMBL: BX640427.PE53

BX640427.PE53        Location/Qualifiers
FT   CDS             complement(51759..52106)
FT                   /transl_table=11
FT                   /locus_tag="BPP1344"
FT                   /product="conserved hypothetical protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2134"
FT                   /db_xref="GOA:Q7WAN0"
FT                   /db_xref="InterPro:IPR006913"
FT                   /db_xref="InterPro:IPR011057"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAN0"
FT                   /protein_id="CAE36646.1"
FT                   /translation="MHYHGSCHCGTIRFDVEGELTGAMSCNCSICRRKGALLWFVPRDH
FT                   LRLATPDEQIATYTFNRHLIKHRFCPTCGIHTHGEGVDQQGRAMAAINIRCLDDVDLDA
FT                   VAVHQYDGRAA"
     MHYHGSCHCG TIRFDVEGEL TGAMSCNCSI CRRKGALLWF VPRDHLRLAT PDEQIATYTF        60
     NRHLIKHRFC PTCGIHTHGE GVDQQGRAMA AINIRCLDDV DLDAVAVHQY DGRAA            115
//

If you have problems or comments...

PBIL Back to PBIL home page