(data stored in ACNUC1104 zone)

EMBL: BX640427.PE54

BX640427.PE54        Location/Qualifiers
FT   CDS             complement(52135..53574)
FT                   /transl_table=11
FT                   /locus_tag="BPP1345"
FT                   /product="putative transmembrane efflux protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2133"
FT                   /db_xref="GOA:Q7WAM9"
FT                   /db_xref="InterPro:IPR004638"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAM9"
FT                   /protein_id="CAE36647.1"
FT                   /translation="MPHTLDERKRWLALMVLCLGVLMIVLDTTIVNVALPSIKADLGFT
FT                   EASLVWVVNAYMLTFGGFLLLGGRLGDLLGQRRMFLAGLTLFTLASLACGMAQGQAMLV
FT                   AARAVQGLGGAVVSAVALSLIMTLFTEPAERARAMGVYGFVCAGGGSIGVLLGGLLTSS
FT                   LSWHWIFLVNLPIGALVYALCLPLLPASQGPTGHPRLDLAGAAAITASLMLAVYAVVNG
FT                   NEAGWTSPQSLGLLALAVALLALFLRIEARVPAPLMPLSLFALRNVATANIVGVLWAAA
FT                   MFAWFFISALYMQLVLGYTAMQVGLGFLPANIIMAAFSLGLSARLVMRFGIRAPLVCGL
FT                   LVAALGLALFARAPVAGSFAVDVLPGMLLLGLGAGIAFNPVLLAAMSDVDPSEAGLASG
FT                   VVNTSFMMGGALGLAVLASLAAGRSASLRAGGADVLTALNGGYHAAFAVGAVFAALAAL
FT                   LAGVLLRRPQPGASAPAADAH"
     MPHTLDERKR WLALMVLCLG VLMIVLDTTI VNVALPSIKA DLGFTEASLV WVVNAYMLTF        60
     GGFLLLGGRL GDLLGQRRMF LAGLTLFTLA SLACGMAQGQ AMLVAARAVQ GLGGAVVSAV       120
     ALSLIMTLFT EPAERARAMG VYGFVCAGGG SIGVLLGGLL TSSLSWHWIF LVNLPIGALV       180
     YALCLPLLPA SQGPTGHPRL DLAGAAAITA SLMLAVYAVV NGNEAGWTSP QSLGLLALAV       240
     ALLALFLRIE ARVPAPLMPL SLFALRNVAT ANIVGVLWAA AMFAWFFISA LYMQLVLGYT       300
     AMQVGLGFLP ANIIMAAFSL GLSARLVMRF GIRAPLVCGL LVAALGLALF ARAPVAGSFA       360
     VDVLPGMLLL GLGAGIAFNP VLLAAMSDVD PSEAGLASGV VNTSFMMGGA LGLAVLASLA       420
     AGRSASLRAG GADVLTALNG GYHAAFAVGA VFAALAALLA GVLLRRPQPG ASAPAADAH        479
//

If you have problems or comments...

PBIL Back to PBIL home page