(data stored in ACNUC1104 zone)

EMBL: BX640427.PE55

BX640427.PE55        Location/Qualifiers
FT   CDS             complement(53593..54012)
FT                   /transl_table=11
FT                   /locus_tag="BPP1346"
FT                   /product="conserved hypothetical protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2132"
FT                   /db_xref="InterPro:IPR028973"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAM8"
FT                   /protein_id="CAE36648.1"
FT                   /translation="MPQISAYLMFDGDCAEAMRLYERILGGKLDALITYGESPPEMPCE
FT                   PQDRDLIMHARLRLDDQLLMASDSNSQCPYEGKKGFSLSLVYPTVSDAQRIFNALAEGG
FT                   QVTMPLQKTFWAEIFGVLVDRHGTAWMISGGQMNS"
     MPQISAYLMF DGDCAEAMRL YERILGGKLD ALITYGESPP EMPCEPQDRD LIMHARLRLD        60
     DQLLMASDSN SQCPYEGKKG FSLSLVYPTV SDAQRIFNAL AEGGQVTMPL QKTFWAEIFG       120
     VLVDRHGTAW MISGGQMNS                                                    139
//

If you have problems or comments...

PBIL Back to PBIL home page